OpenBio*: aj224122-biojava.embl

File aj224122-biojava.embl, 9.2 KB (added by holland, 10 years ago)

biojava embl round-trip

Line 
1ID   AJ224122; SV 3; linear; genomic DNA; STD; PLN; 3827 BP.
2XX   
3AC   AJ224122;
4XX   
5DT   27-FEB-1998 (Rel. 54, Created)
6DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
7XX   
8DE   Arabidopsis thaliana DAG1 gene
9XX   
10KW   BBFa gene; transcription factor.
11XX   
12OS   Arabidopsis thaliana (mouse-ear cress)
13OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
14OS   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
15OS   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
16XX   
17RN   [1]
18RC   revised by [3]
19RP   1-3827
20RA   Vittorioso P.;
21RT   ;
22RL   Submitted (24-FEB-1998) to the EMBL/GenBank/DDBJ databases. Vittorioso P.,
23RL   Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le
24RL   Aldo Moro, 5; , 00185 Rome, ITALY.
25XX   
26RN   [2]
27RP   1-3827
28RX   PUBMED; 8771779.
29RA   De Paolis A., Sabatini S., De Pascalis L., Costantino P. and Capone I.;
30RT   "A rolB regulatory factor belongs to a new class of single zinc finger
31RT   plant proteins";
32RL   Plant J. 10(2):215-223(1996).
33XX   
34RN   [3]
35RC   revised by [4]
36RP   1-3827
37RA   Vittorioso P.;
38RT   ;
39RL   Submitted (25-FEB-1999) to the EMBL/GenBank/DDBJ databases. Vittorioso P.,
40RL   Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le
41RL   Aldo Moro, 5; , 00185 Rome, ITALY.
42XX   
43RN   [4]
44RP   1-3827
45RA   Vittorioso P.;
46RT   ;
47RL   Submitted (12-APR-2001) to the EMBL/GenBank/DDBJ databases. Vittorioso P.,
48RL   Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le
49RL   Aldo Moro, 5; , 00185 Rome, ITALY.
50XX   
51RN   [5]
52RP   1-3827
53RX   PUBMED; 10640273.
54RA   Papi M., Sabatini S., Bouchez D., Camilleri C., Costantino P. and
55RA   Vittorioso P.;
56RT   "Identification and disruption of an Arabidopsis zinc finger gene
57RT   controlling seed germination";
58RL   Genes Dev. 14(1):28-33(2000).
59XX   
60FH   Key             Location/Qualifiers
61FH   
62FT   source          1..3827
63FT                   /chromosome="3"
64FT                   /cultivar="Wassilewskija"
65FT                   /mol_type="genomic DNA"
66FT                   /organism="Arabidopsis thaliana"
67FT                   /db_xref="taxon:3702"
68FT   mRNA            join(1726..1863,2548..3052,3137..3827)
69FT                   /gene="DAG1"
70FT                   /product="DNA-binding protein"
71FT                   /function="transcription factor"
72FT                   /experiment="experimental evidence, no additional details
73FT                   recorded"
74FT   CDS             join(1840..1863,2548..3052,3137..3498)
75FT                   /gene="DAG1"
76FT                   /standard_name="BBFa"
77FT                   /product="DNA-binding protein"
78FT                   /function="transcription factor"
79FT                   /experiment="experimental evidence, no additional details
80FT                   recorded"
81FT                   /protein_id="CAB40190.1"
82FT                   /translation="MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPN
83FT                   ATASNGGSGGNTNNTATMETRKARPQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGC
84FT                   RRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNKDLN
85FT                   LLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTMPDYKQSN
86FT                   NNLSFSIDHHQGIGHNTINSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEKSHGNN
87FT                   TYWNGMFSNTGGSSW"
88FT                   /db_xref="GOA:Q43385"
89FT                   /db_xref="InterPro:IPR003851"
90FT                   /db_xref="UniProtKB/Swiss-Prot:Q43385"
91FT   exon            1726..1863
92FT                   /gene="DAG1"
93FT                   /number="1"
94FT   intron          1864..2547
95FT                   /gene="DAG1"
96FT                   /number="1"
97FT   exon            2548..3052
98FT                   /gene="DAG1"
99FT                   /number="2"
100FT   intron          3053..3136
101FT                   /gene="DAG1"
102FT                   /number="2"
103FT   exon            3137..3495
104FT                   /gene="DAG1"
105FT                   /number="3"
106XX   
107SQ   Sequence 3827 BP; 1216 A; 693 C; 590 G; 1328 T; 0 other;
108     aattaaaacg ccacgcaagg cgattctagg aaatcaaaac gacacgaaat gtggggtggg        60
109     tgtttgggta ggaaagacag ttgtcaacat cagggatttg gattgaatca aaaaaaaagt       120
110     ccttagattt cataaaagct aatcacgcct caaaactggg gcctatctct tcttttttgt       180
111     cgcttcctgt cggtccttct ctatttcttc tccaacccct catttttgaa tatttacata       240
112     acaaaccgtt ttactttctt tggtcaaaat tagacccaaa attctatatt agtttaagat       300
113     atgtggtctg taatttattg ttgtattgat ataaaaatta gttataagcg attatatttt       360
114     tatgctcaag taactggtgt tagttaacta tattccacca cgataacctg attacataaa       420
115     atatgatttt aatcatttta gtaaaccata tcgcacgttg gatgattaat tttaacggtt       480
116     taataacacg tgattaaatt atttttagaa tgattattta caaacggaaa agctatatgt       540
117     gacacaataa ctcgtgcagt attgttagtt tgaaaagtgt atttggtttc ttatatttgg       600
118     cctcgatttt cagtttatgt gctttttaca aagttttatt ttcgttatct gtttaacgcg       660
119     acatttgttg tatggcttta ccgatttgag aataaaatca tattaccttt atgtagccat       720
120     gtgtggtgta atatataata atggtccttc tacgaaaaaa gcagatcaca attgaaataa       780
121     agggtgaaat ttggtgtccc ttttcttcgt cgaaataaca gaactaaata aaagaaagtg       840
122     ttatagtata ttacgtccga agaataatcc atattcctga aatacagtca acatattata       900
123     tatttagtac tttatataaa gttaggaatt aaatcatatg ttttatcgac catattaagt       960
124     cacaacttta tcataaatta atctgtaatt agaattccaa gttcgccacc gaatttcgta      1020
125     acctaatcta catataatag ataaaatata tatatgtaga gtaattatga tatctatgta      1080
126     tgtagtcatg gtatatgaat tttgaaattg gcaaggtaac attgacggat cgtaacccaa      1140
127     caaataatat taattacaaa atgggtgggc gggaatagta tacaactcat aattccactc      1200
128     actttttgta ttattaggat atgaaataag agtaatcaac atgcataata aagatgtata      1260
129     atttcttcat cttaaaaaac ataactacat ggtttaatac acaattttac cttttatcaa      1320
130     aaaagtattt cacaattcac tcgcaaatta cgaaatgatg gctagtgctt caactccaaa      1380
131     tttcgaatat tttaaatcac gatgtgtaga accttttatt tactggatac taatcactag      1440
132     tttattgagc caaccaatta gttaaataga acaatcaata ttatagccag atattttttc      1500
133     ctttaaaaat atttaaaaga ggggccagaa aagaaccaga gagggaggcc atgagacatt      1560
134     attatcacta gtcaaaaaca acaaaccctc cttttgcttt ttcatataaa ttattatatt      1620
135     ttattttgca ggtttcttct cttcttcttc ttcttcttct tcttcttcct cttggctgct      1680
136     ttctttcatc atccataaag tgaaagctaa cgcatagaga gagccatatc gtcccaaaaa      1740
137     aagcaaaagt ccaaaaaaaa acaactccaa aacattctct cttagctctt tactctttag      1800
138     tttctctctc tctctctgcc tttctctttg ttgaagttca tggatgctac gaagtggact      1860
139     caggtacgta aaaagatatc tctctgctat atctgtttgt ttgtagcttc tccccgactc      1920
140     tcacgctctc tctctctctc tctctctctt tgtgtatctc tctactcaca taaatatata      1980
141     catgtgtgtg tatgcatgtt tatatgtatg tatgaaacca gtagtggtta tacagatagt      2040
142     ctatatagag atatcaatat gatgtgtttt aatttagact ttttatatat ccgtttgaaa      2100
143     cttccgaagt tctcgaatgg agttaaggaa gttttgttct ctacaagttc aatttttctt      2160
144     gtcattaatt ataaaactct gataactaat ggataaaaaa ggtatgcttt gttagttacc      2220
145     ttttgttctt ggtgctcagg tcttaccatt tttttcctaa attttaatta gtctcctttc      2280
146     tttaattaat tttatgttaa cgcactgacg atttaacgtt aacaaaaaaa cctagattct      2340
147     ttttcttttc aatagagcat aattattact tcaatttcat ttatctcaca ctaaacccta      2400
148     atcttggcga aattcctttt atatatataa atttaattaa tttttccaca atcttggcgg      2460
149     aattcaggac tcggttttgc ttgttattgt tctctctttt aatttgacat ggttagggaa      2520
150     tacttaaagt atgtcttaat tttatagggt tttcaagaaa tgataaacgt aaagccaatg      2580
151     gagcaaatga tttctagcac caacaacaac acaccgcaac aacaaccaac attcatcgcc      2640
152     accaacacaa ggccaaacgc caccgcatcc aatggtggct ccggaggaaa taccaacaac      2700
153     acggctacga tggaaactag aaaggcgagg ccacaagaga aagtaaattg tccaagatgc      2760
154     aactcaacaa acacaaagtt ctgttattac aacaactaca gtctcacgca accaagatac      2820
155     ttctgcaaag gttgtcgaag gtattggacc gaaggtggct ctcttcgtaa cgtcccagtc      2880
156     ggaggtagct caagaaagaa caagagatcc tctacacctt tagcttcacc ttctaatccc      2940
157     aaacttccag atctaaaccc accgattctt ttctcaagcc aaatccctaa taagtcaaat      3000
158     aaagatctca acttgctatc tttcccggtc atgcaagatc atcatcatca tggtatgtct      3060
159     catttttttc atatgcccaa gatagagaac aacaatactt catcctcaat ctatgcttca      3120
160     tcatctcctg tctcagctct tgagcttcta agatccaatg gagtctcttc aagaggcatg      3180
161     aacacgttct tgcctggtca aatgatggat tcaaactcag tcctgtactc atctttaggg      3240
162     tttccaacaa tgcctgatta caaacagagt aataacaacc tttcattctc cattgatcat      3300
163     catcaaggga ttggacataa caccatcaac agtaaccaaa gagctcaaga taacaatgat      3360
164     gacatgaatg gagcaagtag ggttttgttc cctttttcag acatgaaaga gctttcaagc      3420
165     acaacccaag agaagagtca tggtaataat acatattgga atgggatgtt cagtaataca      3480
166     ggaggatctt catggtgaaa aaaggttaaa aagagctcat gaactatcag ctttcttctc      3540
167     tttttctgtt tttttctcct attttattat agtttttact ttgatgatct tttgtttttt      3600
168     ctcacatggg gaactttact taaagttgtc agaacttagt ttacagattg tctttttatt      3660
169     ccttctttct ggttttcctt ttttcctttt tttatcagtc tttttaaaat atgtatttca      3720
170     taattgggtt tgatcattca tatttattag tatcaaaata gagtctatgt tcatgaggga      3780
171     gtgttaaggg gtgtgagggt agaagaataa gtgaatacgg gggcccg                    3827
172//