OpenBio*: aj224122-biojava.insd

File aj224122-biojava.insd, 22.6 KB (added by markjschreiber, 10 years ago)

biojava roundtrip of ISNDseq

Line 
1<INSDSeq>
2  <INSDSeq_locus>AJ224122</INSDSeq_locus>
3  <INSDSeq_length>3827</INSDSeq_length>
4  <INSDSeq_strandedness>double</INSDSeq_strandedness>
5  <INSDSeq_moltype>DNA</INSDSeq_moltype>
6  <INSDSeq_topology>linear</INSDSeq_topology>
7  <INSDSeq_division>PLN</INSDSeq_division>
8  <INSDSeq_update-date>14-NOV-2006</INSDSeq_update-date>
9  <INSDSeq_create-date>27-FEB-1998</INSDSeq_create-date>
10  <INSDSeq_definition>Arabidopsis thaliana DAG1 gene</INSDSeq_definition>
11  <INSDSeq_accession-version>AJ224122.3</INSDSeq_accession-version>
12  <INSDSeq_other-seqids>
13    <INSDSeqid>emb|AJ224122.3|</INSDSeqid>
14    <INSDSeqid>gi|13938851</INSDSeqid>
15  </INSDSeq_other-seqids>
16  <INSDSeq_keywords>
17    <INSDKeyword>BBFa gene</INSDKeyword>
18    <INSDKeyword>transcription factor</INSDKeyword>
19  </INSDSeq_keywords>
20  <INSDSeq_source>Arabidopsis thaliana (mouse-ear cress)</INSDSeq_source>
21  <INSDSeq_organism>Arabidopsis thaliana</INSDSeq_organism>
22  <INSDSeq_taxonomy>Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis</INSDSeq_taxonomy>
23  <INSDSeq_references>
24    <INSDReference>
25      <INSDReference_reference>1</INSDReference_reference>
26      <INSDReference_position>1..1</INSDReference_position>
27      <INSDReference_authors>
28        <INSDAuthor>De Paolis,A.</INSDAuthor>
29        <INSDAuthor>Sabatini,S.</INSDAuthor>
30        <INSDAuthor>De Pascalis,L.</INSDAuthor>
31        <INSDAuthor>Costantino,P.</INSDAuthor>
32        <INSDAuthor>Capone,I.</INSDAuthor>
33      </INSDReference_authors>
34      <INSDReference_title>A rolB regulatory factor belongs to a new class of single zinc finger plant proteins</INSDReference_title>
35      <INSDReference_journal>Plant J. 10 (2), 215-223 (1996)</INSDReference_journal>
36      <INSDReference_pubmed>8771779</INSDReference_pubmed>
37    </INSDReference>
38    <INSDReference>
39      <INSDReference_reference>2</INSDReference_reference>
40      <INSDReference_position>1..1</INSDReference_position>
41      <INSDReference_authors>
42        <INSDAuthor>Papi,M.</INSDAuthor>
43        <INSDAuthor>Sabatini,S.</INSDAuthor>
44        <INSDAuthor>Bouchez,D.</INSDAuthor>
45        <INSDAuthor>Camilleri,C.</INSDAuthor>
46        <INSDAuthor>Costantino,P.</INSDAuthor>
47        <INSDAuthor>Vittorioso,P.</INSDAuthor>
48      </INSDReference_authors>
49      <INSDReference_title>Identification and disruption of an Arabidopsis zinc finger gene controlling seed germination</INSDReference_title>
50      <INSDReference_journal>Genes Dev. 14 (1), 28-33 (2000)</INSDReference_journal>
51      <INSDReference_pubmed>10640273</INSDReference_pubmed>
52    </INSDReference>
53    <INSDReference>
54      <INSDReference_reference>3</INSDReference_reference>
55      <INSDReference_position>1..1</INSDReference_position>
56      <INSDReference_authors>
57        <INSDAuthor>Vittorioso,P.</INSDAuthor>
58      </INSDReference_authors>
59      <INSDReference_title>Direct Submission</INSDReference_title>
60      <INSDReference_journal>Submitted (24-FEB-1998) Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;, 00185 Rome, ITALY</INSDReference_journal>
61      <INSDReference_remark>revised by [3]</INSDReference_remark>
62    </INSDReference>
63    <INSDReference>
64      <INSDReference_reference>4</INSDReference_reference>
65      <INSDReference_position>1..1</INSDReference_position>
66      <INSDReference_authors>
67        <INSDAuthor>Vittorioso,P.</INSDAuthor>
68      </INSDReference_authors>
69      <INSDReference_title>Direct Submission</INSDReference_title>
70      <INSDReference_journal>Submitted (25-FEB-1999) Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;, 00185 Rome, ITALY</INSDReference_journal>
71      <INSDReference_remark>revised by [4]</INSDReference_remark>
72    </INSDReference>
73    <INSDReference>
74      <INSDReference_reference>5</INSDReference_reference>
75      <INSDReference_position>1..3827</INSDReference_position>
76      <INSDReference_authors>
77        <INSDAuthor>Vittorioso,P.</INSDAuthor>
78      </INSDReference_authors>
79      <INSDReference_title>Direct Submission</INSDReference_title>
80      <INSDReference_journal>Submitted (12-APR-2001) Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;, 00185 Rome, ITALY</INSDReference_journal>
81    </INSDReference>
82  </INSDSeq_references>
83  <INSDSeq_comment>
84On May 3, 2001 this sequence version replaced gi:4469119.
85  </INSDSeq_comment>
86  <INSDSeq_feature-table>
87    <INSDFeature>
88      <INSDFeature_key>source</INSDFeature_key>
89      <INSDFeature_location>1..3827</INSDFeature_location>
90      <INSDFeature_intervals>
91        <INSDInterval>
92          <INSDInterval_from>1</INSDInterval_from>
93          <INSDInterval_to>3827</INSDInterval_to>
94          <INSDInterval_iscomp>false</INSDInterval_iscomp>
95          <INSDInterval_interbp>false</INSDInterval_interbp>
96          <INSDInterval_accession>AJ224122</INSDInterval_accession>
97        </INSDInterval>
98        <INSDFeature_partial5>false</INSDFeature_partial5>
99        <INSDFeature_partial3>false</INSDFeature_partial3>
100      </INSDFeature_intervals>
101      <INSDFeature_quals>
102        <INSDQualifier>
103          <INSDQualifier_name>mol_type</INSDQualifier_name>
104          <INSDQualifier_value>genomic DNA</INSDQualifier_value>
105        </INSDQualifier>
106        <INSDQualifier>
107          <INSDQualifier_name>cultivar</INSDQualifier_name>
108          <INSDQualifier_value>Wassilewskija</INSDQualifier_value>
109        </INSDQualifier>
110        <INSDQualifier>
111          <INSDQualifier_name>chromosome</INSDQualifier_name>
112          <INSDQualifier_value>3</INSDQualifier_value>
113        </INSDQualifier>
114        <INSDQualifier>
115          <INSDQualifier_name>ecotype</INSDQualifier_name>
116          <INSDQualifier_value>Wassilewskija</INSDQualifier_value>
117        </INSDQualifier>
118        <INSDQualifier>
119          <INSDQualifier_name>db_xref</INSDQualifier_name>
120          <INSDQualifier_value>taxon:3702</INSDQualifier_value>
121        </INSDQualifier>
122        <INSDQualifier>
123          <INSDQualifier_name>organism</INSDQualifier_name>
124          <INSDQualifier_value>Arabidopsis thaliana</INSDQualifier_value>
125        </INSDQualifier>
126      </INSDFeature_quals>
127    </INSDFeature>
128    <INSDFeature>
129      <INSDFeature_key>gene</INSDFeature_key>
130      <INSDFeature_location>1726..3827</INSDFeature_location>
131      <INSDFeature_intervals>
132        <INSDInterval>
133          <INSDInterval_from>1726</INSDInterval_from>
134          <INSDInterval_to>3827</INSDInterval_to>
135          <INSDInterval_iscomp>false</INSDInterval_iscomp>
136          <INSDInterval_interbp>false</INSDInterval_interbp>
137          <INSDInterval_accession>AJ224122</INSDInterval_accession>
138        </INSDInterval>
139        <INSDFeature_partial5>false</INSDFeature_partial5>
140        <INSDFeature_partial3>false</INSDFeature_partial3>
141      </INSDFeature_intervals>
142      <INSDFeature_quals>
143        <INSDQualifier>
144          <INSDQualifier_name>gene</INSDQualifier_name>
145          <INSDQualifier_value>DAG1</INSDQualifier_value>
146        </INSDQualifier>
147      </INSDFeature_quals>
148    </INSDFeature>
149    <INSDFeature>
150      <INSDFeature_key>mRNA</INSDFeature_key>
151      <INSDFeature_location>join(1726..1863,2548..3052,3137..3827)</INSDFeature_location>
152      <INSDFeature_intervals>
153        <INSDInterval>
154          <INSDInterval_from>1726</INSDInterval_from>
155          <INSDInterval_to>1863</INSDInterval_to>
156          <INSDInterval_iscomp>false</INSDInterval_iscomp>
157          <INSDInterval_interbp>false</INSDInterval_interbp>
158          <INSDInterval_accession>AJ224122</INSDInterval_accession>
159        </INSDInterval>
160        <INSDInterval>
161          <INSDInterval_from>2548</INSDInterval_from>
162          <INSDInterval_to>3052</INSDInterval_to>
163          <INSDInterval_iscomp>false</INSDInterval_iscomp>
164          <INSDInterval_interbp>false</INSDInterval_interbp>
165          <INSDInterval_accession>AJ224122</INSDInterval_accession>
166        </INSDInterval>
167        <INSDInterval>
168          <INSDInterval_from>3137</INSDInterval_from>
169          <INSDInterval_to>3827</INSDInterval_to>
170          <INSDInterval_iscomp>false</INSDInterval_iscomp>
171          <INSDInterval_interbp>false</INSDInterval_interbp>
172          <INSDInterval_accession>AJ224122</INSDInterval_accession>
173        </INSDInterval>
174        <INSDFeature_operator>join</INSDFeature_operator>
175        <INSDFeature_partial5>false</INSDFeature_partial5>
176        <INSDFeature_partial3>false</INSDFeature_partial3>
177      </INSDFeature_intervals>
178      <INSDFeature_quals>
179        <INSDQualifier>
180          <INSDQualifier_name>gene</INSDQualifier_name>
181          <INSDQualifier_value>DAG1</INSDQualifier_value>
182        </INSDQualifier>
183        <INSDQualifier>
184          <INSDQualifier_name>product</INSDQualifier_name>
185          <INSDQualifier_value>DNA-binding protein</INSDQualifier_value>
186        </INSDQualifier>
187        <INSDQualifier>
188          <INSDQualifier_name>experiment</INSDQualifier_name>
189          <INSDQualifier_value>experimental evidence, no additional details recorded</INSDQualifier_value>
190        </INSDQualifier>
191        <INSDQualifier>
192          <INSDQualifier_name>function</INSDQualifier_name>
193          <INSDQualifier_value>transcription factor</INSDQualifier_value>
194        </INSDQualifier>
195      </INSDFeature_quals>
196    </INSDFeature>
197    <INSDFeature>
198      <INSDFeature_key>exon</INSDFeature_key>
199      <INSDFeature_location>1726..1863</INSDFeature_location>
200      <INSDFeature_intervals>
201        <INSDInterval>
202          <INSDInterval_from>1726</INSDInterval_from>
203          <INSDInterval_to>1863</INSDInterval_to>
204          <INSDInterval_iscomp>false</INSDInterval_iscomp>
205          <INSDInterval_interbp>false</INSDInterval_interbp>
206          <INSDInterval_accession>AJ224122</INSDInterval_accession>
207        </INSDInterval>
208        <INSDFeature_partial5>false</INSDFeature_partial5>
209        <INSDFeature_partial3>false</INSDFeature_partial3>
210      </INSDFeature_intervals>
211      <INSDFeature_quals>
212        <INSDQualifier>
213          <INSDQualifier_name>gene</INSDQualifier_name>
214          <INSDQualifier_value>DAG1</INSDQualifier_value>
215        </INSDQualifier>
216        <INSDQualifier>
217          <INSDQualifier_name>number</INSDQualifier_name>
218          <INSDQualifier_value>1</INSDQualifier_value>
219        </INSDQualifier>
220      </INSDFeature_quals>
221    </INSDFeature>
222    <INSDFeature>
223      <INSDFeature_key>CDS</INSDFeature_key>
224      <INSDFeature_location>join(1840..1863,2548..3052,3137..3498)</INSDFeature_location>
225      <INSDFeature_intervals>
226        <INSDInterval>
227          <INSDInterval_from>1840</INSDInterval_from>
228          <INSDInterval_to>1863</INSDInterval_to>
229          <INSDInterval_iscomp>false</INSDInterval_iscomp>
230          <INSDInterval_interbp>false</INSDInterval_interbp>
231          <INSDInterval_accession>AJ224122</INSDInterval_accession>
232        </INSDInterval>
233        <INSDInterval>
234          <INSDInterval_from>2548</INSDInterval_from>
235          <INSDInterval_to>3052</INSDInterval_to>
236          <INSDInterval_iscomp>false</INSDInterval_iscomp>
237          <INSDInterval_interbp>false</INSDInterval_interbp>
238          <INSDInterval_accession>AJ224122</INSDInterval_accession>
239        </INSDInterval>
240        <INSDInterval>
241          <INSDInterval_from>3137</INSDInterval_from>
242          <INSDInterval_to>3498</INSDInterval_to>
243          <INSDInterval_iscomp>false</INSDInterval_iscomp>
244          <INSDInterval_interbp>false</INSDInterval_interbp>
245          <INSDInterval_accession>AJ224122</INSDInterval_accession>
246        </INSDInterval>
247        <INSDFeature_operator>join</INSDFeature_operator>
248        <INSDFeature_partial5>false</INSDFeature_partial5>
249        <INSDFeature_partial3>false</INSDFeature_partial3>
250      </INSDFeature_intervals>
251      <INSDFeature_quals>
252        <INSDQualifier>
253          <INSDQualifier_name>gene</INSDQualifier_name>
254          <INSDQualifier_value>DAG1</INSDQualifier_value>
255        </INSDQualifier>
256        <INSDQualifier>
257          <INSDQualifier_name>function</INSDQualifier_name>
258          <INSDQualifier_value>transcription factor</INSDQualifier_value>
259        </INSDQualifier>
260        <INSDQualifier>
261          <INSDQualifier_name>standard_name</INSDQualifier_name>
262          <INSDQualifier_value>BBFa</INSDQualifier_value>
263        </INSDQualifier>
264        <INSDQualifier>
265          <INSDQualifier_name>experiment</INSDQualifier_name>
266          <INSDQualifier_value>experimental evidence, no additional details recorded</INSDQualifier_value>
267        </INSDQualifier>
268        <INSDQualifier>
269          <INSDQualifier_name>codon_start</INSDQualifier_name>
270          <INSDQualifier_value>1</INSDQualifier_value>
271        </INSDQualifier>
272        <INSDQualifier>
273          <INSDQualifier_name>transl_table</INSDQualifier_name>
274          <INSDQualifier_value>1</INSDQualifier_value>
275        </INSDQualifier>
276        <INSDQualifier>
277          <INSDQualifier_name>product</INSDQualifier_name>
278          <INSDQualifier_value>DNA-binding protein</INSDQualifier_value>
279        </INSDQualifier>
280        <INSDQualifier>
281          <INSDQualifier_name>protein_id</INSDQualifier_name>
282          <INSDQualifier_value>CAB40190.1</INSDQualifier_value>
283        </INSDQualifier>
284        <INSDQualifier>
285          <INSDQualifier_name>translation</INSDQualifier_name>
286          <INSDQualifier_value>
287MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPNATASNGGSGGNTNNTATMETRKARPQEKVNCPRCN
288STNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNK
289DLNLLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTMPDYKQSNNNLSFSIDHHQGIGHNTI
290NSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEKSHGNNTYWNGMFSNTGGSSW
291          </INSDQualifier_value>
292        </INSDQualifier>
293        <INSDQualifier>
294          <INSDQualifier_name>db_xref</INSDQualifier_name>
295          <INSDQualifier_value>GI:4581965</INSDQualifier_value>
296        </INSDQualifier>
297        <INSDQualifier>
298          <INSDQualifier_name>db_xref</INSDQualifier_name>
299          <INSDQualifier_value>GOA:Q43385</INSDQualifier_value>
300        </INSDQualifier>
301        <INSDQualifier>
302          <INSDQualifier_name>db_xref</INSDQualifier_name>
303          <INSDQualifier_value>InterPro:IPR003851</INSDQualifier_value>
304        </INSDQualifier>
305        <INSDQualifier>
306          <INSDQualifier_name>db_xref</INSDQualifier_name>
307          <INSDQualifier_value>UniProtKB/Swiss-Prot:Q43385</INSDQualifier_value>
308        </INSDQualifier>
309      </INSDFeature_quals>
310    </INSDFeature>
311    <INSDFeature>
312      <INSDFeature_key>intron</INSDFeature_key>
313      <INSDFeature_location>1864..2547</INSDFeature_location>
314      <INSDFeature_intervals>
315        <INSDInterval>
316          <INSDInterval_from>1864</INSDInterval_from>
317          <INSDInterval_to>2547</INSDInterval_to>
318          <INSDInterval_iscomp>false</INSDInterval_iscomp>
319          <INSDInterval_interbp>false</INSDInterval_interbp>
320          <INSDInterval_accession>AJ224122</INSDInterval_accession>
321        </INSDInterval>
322        <INSDFeature_partial5>false</INSDFeature_partial5>
323        <INSDFeature_partial3>false</INSDFeature_partial3>
324      </INSDFeature_intervals>
325      <INSDFeature_quals>
326        <INSDQualifier>
327          <INSDQualifier_name>gene</INSDQualifier_name>
328          <INSDQualifier_value>DAG1</INSDQualifier_value>
329        </INSDQualifier>
330        <INSDQualifier>
331          <INSDQualifier_name>number</INSDQualifier_name>
332          <INSDQualifier_value>1</INSDQualifier_value>
333        </INSDQualifier>
334      </INSDFeature_quals>
335    </INSDFeature>
336    <INSDFeature>
337      <INSDFeature_key>exon</INSDFeature_key>
338      <INSDFeature_location>2548..3052</INSDFeature_location>
339      <INSDFeature_intervals>
340        <INSDInterval>
341          <INSDInterval_from>2548</INSDInterval_from>
342          <INSDInterval_to>3052</INSDInterval_to>
343          <INSDInterval_iscomp>false</INSDInterval_iscomp>
344          <INSDInterval_interbp>false</INSDInterval_interbp>
345          <INSDInterval_accession>AJ224122</INSDInterval_accession>
346        </INSDInterval>
347        <INSDFeature_partial5>false</INSDFeature_partial5>
348        <INSDFeature_partial3>false</INSDFeature_partial3>
349      </INSDFeature_intervals>
350      <INSDFeature_quals>
351        <INSDQualifier>
352          <INSDQualifier_name>gene</INSDQualifier_name>
353          <INSDQualifier_value>DAG1</INSDQualifier_value>
354        </INSDQualifier>
355        <INSDQualifier>
356          <INSDQualifier_name>number</INSDQualifier_name>
357          <INSDQualifier_value>2</INSDQualifier_value>
358        </INSDQualifier>
359      </INSDFeature_quals>
360    </INSDFeature>
361    <INSDFeature>
362      <INSDFeature_key>intron</INSDFeature_key>
363      <INSDFeature_location>3053..3136</INSDFeature_location>
364      <INSDFeature_intervals>
365        <INSDInterval>
366          <INSDInterval_from>3053</INSDInterval_from>
367          <INSDInterval_to>3136</INSDInterval_to>
368          <INSDInterval_iscomp>false</INSDInterval_iscomp>
369          <INSDInterval_interbp>false</INSDInterval_interbp>
370          <INSDInterval_accession>AJ224122</INSDInterval_accession>
371        </INSDInterval>
372        <INSDFeature_partial5>false</INSDFeature_partial5>
373        <INSDFeature_partial3>false</INSDFeature_partial3>
374      </INSDFeature_intervals>
375      <INSDFeature_quals>
376        <INSDQualifier>
377          <INSDQualifier_name>gene</INSDQualifier_name>
378          <INSDQualifier_value>DAG1</INSDQualifier_value>
379        </INSDQualifier>
380        <INSDQualifier>
381          <INSDQualifier_name>number</INSDQualifier_name>
382          <INSDQualifier_value>2</INSDQualifier_value>
383        </INSDQualifier>
384      </INSDFeature_quals>
385    </INSDFeature>
386    <INSDFeature>
387      <INSDFeature_key>exon</INSDFeature_key>
388      <INSDFeature_location>3137..3495</INSDFeature_location>
389      <INSDFeature_intervals>
390        <INSDInterval>
391          <INSDInterval_from>3137</INSDInterval_from>
392          <INSDInterval_to>3495</INSDInterval_to>
393          <INSDInterval_iscomp>false</INSDInterval_iscomp>
394          <INSDInterval_interbp>false</INSDInterval_interbp>
395          <INSDInterval_accession>AJ224122</INSDInterval_accession>
396        </INSDInterval>
397        <INSDFeature_partial5>false</INSDFeature_partial5>
398        <INSDFeature_partial3>false</INSDFeature_partial3>
399      </INSDFeature_intervals>
400      <INSDFeature_quals>
401        <INSDQualifier>
402          <INSDQualifier_name>gene</INSDQualifier_name>
403          <INSDQualifier_value>DAG1</INSDQualifier_value>
404        </INSDQualifier>
405        <INSDQualifier>
406          <INSDQualifier_name>number</INSDQualifier_name>
407          <INSDQualifier_value>3</INSDQualifier_value>
408        </INSDQualifier>
409      </INSDFeature_quals>
410    </INSDFeature>
411  </INSDSeq_feature-table>
412  <INSDSeq_sequence>
413aattaaaacgccacgcaaggcgattctaggaaatcaaaacgacacgaaatgtggggtgggtgtttgggtaggaaagacag
414ttgtcaacatcagggatttggattgaatcaaaaaaaaagtccttagatttcataaaagctaatcacgcctcaaaactggg
415gcctatctcttcttttttgtcgcttcctgtcggtccttctctatttcttctccaacccctcatttttgaatatttacata
416acaaaccgttttactttctttggtcaaaattagacccaaaattctatattagtttaagatatgtggtctgtaatttattg
417ttgtattgatataaaaattagttataagcgattatatttttatgctcaagtaactggtgttagttaactatattccacca
418cgataacctgattacataaaatatgattttaatcattttagtaaaccatatcgcacgttggatgattaattttaacggtt
419taataacacgtgattaaattatttttagaatgattatttacaaacggaaaagctatatgtgacacaataactcgtgcagt
420attgttagtttgaaaagtgtatttggtttcttatatttggcctcgattttcagtttatgtgctttttacaaagttttatt
421ttcgttatctgtttaacgcgacatttgttgtatggctttaccgatttgagaataaaatcatattacctttatgtagccat
422gtgtggtgtaatatataataatggtccttctacgaaaaaagcagatcacaattgaaataaagggtgaaatttggtgtccc
423ttttcttcgtcgaaataacagaactaaataaaagaaagtgttatagtatattacgtccgaagaataatccatattcctga
424aatacagtcaacatattatatatttagtactttatataaagttaggaattaaatcatatgttttatcgaccatattaagt
425cacaactttatcataaattaatctgtaattagaattccaagttcgccaccgaatttcgtaacctaatctacatataatag
426ataaaatatatatatgtagagtaattatgatatctatgtatgtagtcatggtatatgaattttgaaattggcaaggtaac
427attgacggatcgtaacccaacaaataatattaattacaaaatgggtgggcgggaatagtatacaactcataattccactc
428actttttgtattattaggatatgaaataagagtaatcaacatgcataataaagatgtataatttcttcatcttaaaaaac
429ataactacatggtttaatacacaattttaccttttatcaaaaaagtatttcacaattcactcgcaaattacgaaatgatg
430gctagtgcttcaactccaaatttcgaatattttaaatcacgatgtgtagaaccttttatttactggatactaatcactag
431tttattgagccaaccaattagttaaatagaacaatcaatattatagccagatattttttcctttaaaaatatttaaaaga
432ggggccagaaaagaaccagagagggaggccatgagacattattatcactagtcaaaaacaacaaaccctccttttgcttt
433ttcatataaattattatattttattttgcaggtttcttctcttcttcttcttcttcttcttcttcttcctcttggctgct
434ttctttcatcatccataaagtgaaagctaacgcatagagagagccatatcgtcccaaaaaaagcaaaagtccaaaaaaaa
435acaactccaaaacattctctcttagctctttactctttagtttctctctctctctctgcctttctctttgttgaagttca
436tggatgctacgaagtggactcaggtacgtaaaaagatatctctctgctatatctgtttgtttgtagcttctccccgactc
437tcacgctctctctctctctctctctctctttgtgtatctctctactcacataaatatatacatgtgtgtgtatgcatgtt
438tatatgtatgtatgaaaccagtagtggttatacagatagtctatatagagatatcaatatgatgtgttttaatttagact
439ttttatatatccgtttgaaacttccgaagttctcgaatggagttaaggaagttttgttctctacaagttcaatttttctt
440gtcattaattataaaactctgataactaatggataaaaaaggtatgctttgttagttaccttttgttcttggtgctcagg
441tcttaccatttttttcctaaattttaattagtctcctttctttaattaattttatgttaacgcactgacgatttaacgtt
442aacaaaaaaacctagattctttttcttttcaatagagcataattattacttcaatttcatttatctcacactaaacccta
443atcttggcgaaattccttttatatatataaatttaattaatttttccacaatcttggcggaattcaggactcggttttgc
444ttgttattgttctctcttttaatttgacatggttagggaatacttaaagtatgtcttaattttatagggttttcaagaaa
445tgataaacgtaaagccaatggagcaaatgatttctagcaccaacaacaacacaccgcaacaacaaccaacattcatcgcc
446accaacacaaggccaaacgccaccgcatccaatggtggctccggaggaaataccaacaacacggctacgatggaaactag
447aaaggcgaggccacaagagaaagtaaattgtccaagatgcaactcaacaaacacaaagttctgttattacaacaactaca
448gtctcacgcaaccaagatacttctgcaaaggttgtcgaaggtattggaccgaaggtggctctcttcgtaacgtcccagtc
449ggaggtagctcaagaaagaacaagagatcctctacacctttagcttcaccttctaatcccaaacttccagatctaaaccc
450accgattcttttctcaagccaaatccctaataagtcaaataaagatctcaacttgctatctttcccggtcatgcaagatc
451atcatcatcatggtatgtctcatttttttcatatgcccaagatagagaacaacaatacttcatcctcaatctatgcttca
452tcatctcctgtctcagctcttgagcttctaagatccaatggagtctcttcaagaggcatgaacacgttcttgcctggtca
453aatgatggattcaaactcagtcctgtactcatctttagggtttccaacaatgcctgattacaaacagagtaataacaacc
454tttcattctccattgatcatcatcaagggattggacataacaccatcaacagtaaccaaagagctcaagataacaatgat
455gacatgaatggagcaagtagggttttgttccctttttcagacatgaaagagctttcaagcacaacccaagagaagagtca
456tggtaataatacatattggaatgggatgttcagtaatacaggaggatcttcatggtgaaaaaaggttaaaaagagctcat
457gaactatcagctttcttctctttttctgtttttttctcctattttattatagtttttactttgatgatcttttgtttttt
458ctcacatggggaactttacttaaagttgtcagaacttagtttacagattgtctttttattccttctttctggttttcctt
459ttttcctttttttatcagtctttttaaaatatgtatttcataattgggtttgatcattcatatttattagtatcaaaata
460gagtctatgttcatgagggagtgttaaggggtgtgagggtagaagaataagtgaatacgggggcccg
461  </INSDSeq_sequence>
462</INSDSeq>