OpenBio*: aj224122-biojava.insd.xml

File aj224122-biojava.insd.xml, 23.6 KB (added by markjschreiber, 11 years ago)

biojava round trip of INSDseq

Line 
1<?xml version="1.0" encoding="UTF-8" ?>
2<!DOCTYPE INSDSeq PUBLIC "-//EMBL-EBI//INSD INSDSeq/EN" "http://www.ebi.ac.uk/dtd/INSD_INSDSeq.dtd">
3<INSDSet>
4  <INSDSeq>
5    <INSDSeq_locus>AJ224122</INSDSeq_locus>
6    <INSDSeq_length>3827</INSDSeq_length>
7    <INSDSeq_strandedness>double</INSDSeq_strandedness>
8    <INSDSeq_moltype>DNA</INSDSeq_moltype>
9    <INSDSeq_topology>linear</INSDSeq_topology>
10    <INSDSeq_division>PLN</INSDSeq_division>
11    <INSDSeq_update-date>14-NOV-2006</INSDSeq_update-date>
12    <INSDSeq_create-date>27-FEB-1998</INSDSeq_create-date>
13    <INSDSeq_definition>Arabidopsis thaliana DAG1 gene</INSDSeq_definition>
14    <INSDSeq_accession-version>AJ224122.3</INSDSeq_accession-version>
15    <INSDSeq_other-seqids>
16      <INSDSeqid>emb|AJ224122.3|</INSDSeqid>
17      <INSDSeqid>gi|13938851</INSDSeqid>
18    </INSDSeq_other-seqids>
19    <INSDSeq_keywords>
20      <INSDKeyword>BBFa gene</INSDKeyword>
21      <INSDKeyword>transcription factor</INSDKeyword>
22    </INSDSeq_keywords>
23    <INSDSeq_source>Arabidopsis thaliana (mouse-ear cress)</INSDSeq_source>
24    <INSDSeq_organism>Arabidopsis thaliana</INSDSeq_organism>
25    <INSDSeq_taxonomy>Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis</INSDSeq_taxonomy>
26    <INSDSeq_references>
27      <INSDReference>
28        <INSDReference_reference>1</INSDReference_reference>
29        <INSDReference_position>1..1</INSDReference_position>
30        <INSDReference_authors>
31          <INSDAuthor>De Paolis,A.</INSDAuthor>
32          <INSDAuthor>Sabatini,S.</INSDAuthor>
33          <INSDAuthor>De Pascalis,L.</INSDAuthor>
34          <INSDAuthor>Costantino,P.</INSDAuthor>
35          <INSDAuthor>Capone,I.</INSDAuthor>
36        </INSDReference_authors>
37        <INSDReference_title>A rolB regulatory factor belongs to a new class of single zinc finger plant proteins</INSDReference_title>
38        <INSDReference_journal>Plant J. 10 (2), 215-223 (1996)</INSDReference_journal>
39        <INSDReference_pubmed>8771779</INSDReference_pubmed>
40      </INSDReference>
41      <INSDReference>
42        <INSDReference_reference>2</INSDReference_reference>
43        <INSDReference_position>1..1</INSDReference_position>
44        <INSDReference_authors>
45          <INSDAuthor>Papi,M.</INSDAuthor>
46          <INSDAuthor>Sabatini,S.</INSDAuthor>
47          <INSDAuthor>Bouchez,D.</INSDAuthor>
48          <INSDAuthor>Camilleri,C.</INSDAuthor>
49          <INSDAuthor>Costantino,P.</INSDAuthor>
50          <INSDAuthor>Vittorioso,P.</INSDAuthor>
51        </INSDReference_authors>
52        <INSDReference_title>Identification and disruption of an Arabidopsis zinc finger gene controlling seed germination</INSDReference_title>
53        <INSDReference_journal>Genes Dev. 14 (1), 28-33 (2000)</INSDReference_journal>
54        <INSDReference_pubmed>10640273</INSDReference_pubmed>
55      </INSDReference>
56      <INSDReference>
57        <INSDReference_reference>3</INSDReference_reference>
58        <INSDReference_position>1..1</INSDReference_position>
59        <INSDReference_authors>
60          <INSDAuthor>Vittorioso,P.</INSDAuthor>
61        </INSDReference_authors>
62        <INSDReference_title>Direct Submission</INSDReference_title>
63        <INSDReference_journal>Submitted (24-FEB-1998) Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;, 00185 Rome, ITALY</INSDReference_journal>
64        <INSDReference_remark>revised by [3]</INSDReference_remark>
65      </INSDReference>
66      <INSDReference>
67        <INSDReference_reference>4</INSDReference_reference>
68        <INSDReference_position>1..1</INSDReference_position>
69        <INSDReference_authors>
70          <INSDAuthor>Vittorioso,P.</INSDAuthor>
71        </INSDReference_authors>
72        <INSDReference_title>Direct Submission</INSDReference_title>
73        <INSDReference_journal>Submitted (25-FEB-1999) Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;, 00185 Rome, ITALY</INSDReference_journal>
74        <INSDReference_remark>revised by [4]</INSDReference_remark>
75      </INSDReference>
76      <INSDReference>
77        <INSDReference_reference>5</INSDReference_reference>
78        <INSDReference_position>1..3827</INSDReference_position>
79        <INSDReference_authors>
80          <INSDAuthor>Vittorioso,P.</INSDAuthor>
81        </INSDReference_authors>
82        <INSDReference_title>Direct Submission</INSDReference_title>
83        <INSDReference_journal>Submitted (12-APR-2001) Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;, 00185 Rome, ITALY</INSDReference_journal>
84      </INSDReference>
85    </INSDSeq_references>
86    <INSDSeq_comment>
87On May 3, 2001 this sequence version replaced gi:4469119.
88    </INSDSeq_comment>
89    <INSDSeq_feature-table>
90      <INSDFeature>
91        <INSDFeature_key>source</INSDFeature_key>
92        <INSDFeature_location>1..3827</INSDFeature_location>
93        <INSDFeature_intervals>
94          <INSDInterval>
95            <INSDInterval_from>1</INSDInterval_from>
96            <INSDInterval_to>3827</INSDInterval_to>
97            <INSDInterval_iscomp>false</INSDInterval_iscomp>
98            <INSDInterval_interbp>false</INSDInterval_interbp>
99            <INSDInterval_accession>AJ224122</INSDInterval_accession>
100          </INSDInterval>
101          <INSDFeature_partial5>false</INSDFeature_partial5>
102          <INSDFeature_partial3>false</INSDFeature_partial3>
103        </INSDFeature_intervals>
104        <INSDFeature_quals>
105          <INSDQualifier>
106            <INSDQualifier_name>mol_type</INSDQualifier_name>
107            <INSDQualifier_value>genomic DNA</INSDQualifier_value>
108          </INSDQualifier>
109          <INSDQualifier>
110            <INSDQualifier_name>cultivar</INSDQualifier_name>
111            <INSDQualifier_value>Wassilewskija</INSDQualifier_value>
112          </INSDQualifier>
113          <INSDQualifier>
114            <INSDQualifier_name>chromosome</INSDQualifier_name>
115            <INSDQualifier_value>3</INSDQualifier_value>
116          </INSDQualifier>
117          <INSDQualifier>
118            <INSDQualifier_name>ecotype</INSDQualifier_name>
119            <INSDQualifier_value>Wassilewskija</INSDQualifier_value>
120          </INSDQualifier>
121          <INSDQualifier>
122            <INSDQualifier_name>db_xref</INSDQualifier_name>
123            <INSDQualifier_value>taxon:3702</INSDQualifier_value>
124          </INSDQualifier>
125          <INSDQualifier>
126            <INSDQualifier_name>organism</INSDQualifier_name>
127            <INSDQualifier_value>Arabidopsis thaliana</INSDQualifier_value>
128          </INSDQualifier>
129        </INSDFeature_quals>
130      </INSDFeature>
131      <INSDFeature>
132        <INSDFeature_key>gene</INSDFeature_key>
133        <INSDFeature_location>1726..3827</INSDFeature_location>
134        <INSDFeature_intervals>
135          <INSDInterval>
136            <INSDInterval_from>1726</INSDInterval_from>
137            <INSDInterval_to>3827</INSDInterval_to>
138            <INSDInterval_iscomp>false</INSDInterval_iscomp>
139            <INSDInterval_interbp>false</INSDInterval_interbp>
140            <INSDInterval_accession>AJ224122</INSDInterval_accession>
141          </INSDInterval>
142          <INSDFeature_partial5>false</INSDFeature_partial5>
143          <INSDFeature_partial3>false</INSDFeature_partial3>
144        </INSDFeature_intervals>
145        <INSDFeature_quals>
146          <INSDQualifier>
147            <INSDQualifier_name>gene</INSDQualifier_name>
148            <INSDQualifier_value>DAG1</INSDQualifier_value>
149          </INSDQualifier>
150        </INSDFeature_quals>
151      </INSDFeature>
152      <INSDFeature>
153        <INSDFeature_key>mRNA</INSDFeature_key>
154        <INSDFeature_location>join(1726..1863,2548..3052,3137..3827)</INSDFeature_location>
155        <INSDFeature_intervals>
156          <INSDInterval>
157            <INSDInterval_from>1726</INSDInterval_from>
158            <INSDInterval_to>1863</INSDInterval_to>
159            <INSDInterval_iscomp>false</INSDInterval_iscomp>
160            <INSDInterval_interbp>false</INSDInterval_interbp>
161            <INSDInterval_accession>AJ224122</INSDInterval_accession>
162          </INSDInterval>
163          <INSDInterval>
164            <INSDInterval_from>2548</INSDInterval_from>
165            <INSDInterval_to>3052</INSDInterval_to>
166            <INSDInterval_iscomp>false</INSDInterval_iscomp>
167            <INSDInterval_interbp>false</INSDInterval_interbp>
168            <INSDInterval_accession>AJ224122</INSDInterval_accession>
169          </INSDInterval>
170          <INSDInterval>
171            <INSDInterval_from>3137</INSDInterval_from>
172            <INSDInterval_to>3827</INSDInterval_to>
173            <INSDInterval_iscomp>false</INSDInterval_iscomp>
174            <INSDInterval_interbp>false</INSDInterval_interbp>
175            <INSDInterval_accession>AJ224122</INSDInterval_accession>
176          </INSDInterval>
177          <INSDFeature_operator>join</INSDFeature_operator>
178          <INSDFeature_partial5>false</INSDFeature_partial5>
179          <INSDFeature_partial3>false</INSDFeature_partial3>
180        </INSDFeature_intervals>
181        <INSDFeature_quals>
182          <INSDQualifier>
183            <INSDQualifier_name>gene</INSDQualifier_name>
184            <INSDQualifier_value>DAG1</INSDQualifier_value>
185          </INSDQualifier>
186          <INSDQualifier>
187            <INSDQualifier_name>product</INSDQualifier_name>
188            <INSDQualifier_value>DNA-binding protein</INSDQualifier_value>
189          </INSDQualifier>
190          <INSDQualifier>
191            <INSDQualifier_name>experiment</INSDQualifier_name>
192            <INSDQualifier_value>experimental evidence, no additional details recorded</INSDQualifier_value>
193          </INSDQualifier>
194          <INSDQualifier>
195            <INSDQualifier_name>function</INSDQualifier_name>
196            <INSDQualifier_value>transcription factor</INSDQualifier_value>
197          </INSDQualifier>
198        </INSDFeature_quals>
199      </INSDFeature>
200      <INSDFeature>
201        <INSDFeature_key>exon</INSDFeature_key>
202        <INSDFeature_location>1726..1863</INSDFeature_location>
203        <INSDFeature_intervals>
204          <INSDInterval>
205            <INSDInterval_from>1726</INSDInterval_from>
206            <INSDInterval_to>1863</INSDInterval_to>
207            <INSDInterval_iscomp>false</INSDInterval_iscomp>
208            <INSDInterval_interbp>false</INSDInterval_interbp>
209            <INSDInterval_accession>AJ224122</INSDInterval_accession>
210          </INSDInterval>
211          <INSDFeature_partial5>false</INSDFeature_partial5>
212          <INSDFeature_partial3>false</INSDFeature_partial3>
213        </INSDFeature_intervals>
214        <INSDFeature_quals>
215          <INSDQualifier>
216            <INSDQualifier_name>gene</INSDQualifier_name>
217            <INSDQualifier_value>DAG1</INSDQualifier_value>
218          </INSDQualifier>
219          <INSDQualifier>
220            <INSDQualifier_name>number</INSDQualifier_name>
221            <INSDQualifier_value>1</INSDQualifier_value>
222          </INSDQualifier>
223        </INSDFeature_quals>
224      </INSDFeature>
225      <INSDFeature>
226        <INSDFeature_key>CDS</INSDFeature_key>
227        <INSDFeature_location>join(1840..1863,2548..3052,3137..3498)</INSDFeature_location>
228        <INSDFeature_intervals>
229          <INSDInterval>
230            <INSDInterval_from>1840</INSDInterval_from>
231            <INSDInterval_to>1863</INSDInterval_to>
232            <INSDInterval_iscomp>false</INSDInterval_iscomp>
233            <INSDInterval_interbp>false</INSDInterval_interbp>
234            <INSDInterval_accession>AJ224122</INSDInterval_accession>
235          </INSDInterval>
236          <INSDInterval>
237            <INSDInterval_from>2548</INSDInterval_from>
238            <INSDInterval_to>3052</INSDInterval_to>
239            <INSDInterval_iscomp>false</INSDInterval_iscomp>
240            <INSDInterval_interbp>false</INSDInterval_interbp>
241            <INSDInterval_accession>AJ224122</INSDInterval_accession>
242          </INSDInterval>
243          <INSDInterval>
244            <INSDInterval_from>3137</INSDInterval_from>
245            <INSDInterval_to>3498</INSDInterval_to>
246            <INSDInterval_iscomp>false</INSDInterval_iscomp>
247            <INSDInterval_interbp>false</INSDInterval_interbp>
248            <INSDInterval_accession>AJ224122</INSDInterval_accession>
249          </INSDInterval>
250          <INSDFeature_operator>join</INSDFeature_operator>
251          <INSDFeature_partial5>false</INSDFeature_partial5>
252          <INSDFeature_partial3>false</INSDFeature_partial3>
253        </INSDFeature_intervals>
254        <INSDFeature_quals>
255          <INSDQualifier>
256            <INSDQualifier_name>gene</INSDQualifier_name>
257            <INSDQualifier_value>DAG1</INSDQualifier_value>
258          </INSDQualifier>
259          <INSDQualifier>
260            <INSDQualifier_name>function</INSDQualifier_name>
261            <INSDQualifier_value>transcription factor</INSDQualifier_value>
262          </INSDQualifier>
263          <INSDQualifier>
264            <INSDQualifier_name>standard_name</INSDQualifier_name>
265            <INSDQualifier_value>BBFa</INSDQualifier_value>
266          </INSDQualifier>
267          <INSDQualifier>
268            <INSDQualifier_name>experiment</INSDQualifier_name>
269            <INSDQualifier_value>experimental evidence, no additional details recorded</INSDQualifier_value>
270          </INSDQualifier>
271          <INSDQualifier>
272            <INSDQualifier_name>codon_start</INSDQualifier_name>
273            <INSDQualifier_value>1</INSDQualifier_value>
274          </INSDQualifier>
275          <INSDQualifier>
276            <INSDQualifier_name>transl_table</INSDQualifier_name>
277            <INSDQualifier_value>1</INSDQualifier_value>
278          </INSDQualifier>
279          <INSDQualifier>
280            <INSDQualifier_name>product</INSDQualifier_name>
281            <INSDQualifier_value>DNA-binding protein</INSDQualifier_value>
282          </INSDQualifier>
283          <INSDQualifier>
284            <INSDQualifier_name>protein_id</INSDQualifier_name>
285            <INSDQualifier_value>CAB40190.1</INSDQualifier_value>
286          </INSDQualifier>
287          <INSDQualifier>
288            <INSDQualifier_name>translation</INSDQualifier_name>
289            <INSDQualifier_value>
290MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPNATASNGGSGGNTNNTATMETRKARPQEKVNCPRCN
291STNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNK
292DLNLLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTMPDYKQSNNNLSFSIDHHQGIGHNTI
293NSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEKSHGNNTYWNGMFSNTGGSSW
294            </INSDQualifier_value>
295          </INSDQualifier>
296          <INSDQualifier>
297            <INSDQualifier_name>db_xref</INSDQualifier_name>
298            <INSDQualifier_value>GI:4581965</INSDQualifier_value>
299          </INSDQualifier>
300          <INSDQualifier>
301            <INSDQualifier_name>db_xref</INSDQualifier_name>
302            <INSDQualifier_value>GOA:Q43385</INSDQualifier_value>
303          </INSDQualifier>
304          <INSDQualifier>
305            <INSDQualifier_name>db_xref</INSDQualifier_name>
306            <INSDQualifier_value>InterPro:IPR003851</INSDQualifier_value>
307          </INSDQualifier>
308          <INSDQualifier>
309            <INSDQualifier_name>db_xref</INSDQualifier_name>
310            <INSDQualifier_value>UniProtKB/Swiss-Prot:Q43385</INSDQualifier_value>
311          </INSDQualifier>
312        </INSDFeature_quals>
313      </INSDFeature>
314      <INSDFeature>
315        <INSDFeature_key>intron</INSDFeature_key>
316        <INSDFeature_location>1864..2547</INSDFeature_location>
317        <INSDFeature_intervals>
318          <INSDInterval>
319            <INSDInterval_from>1864</INSDInterval_from>
320            <INSDInterval_to>2547</INSDInterval_to>
321            <INSDInterval_iscomp>false</INSDInterval_iscomp>
322            <INSDInterval_interbp>false</INSDInterval_interbp>
323            <INSDInterval_accession>AJ224122</INSDInterval_accession>
324          </INSDInterval>
325          <INSDFeature_partial5>false</INSDFeature_partial5>
326          <INSDFeature_partial3>false</INSDFeature_partial3>
327        </INSDFeature_intervals>
328        <INSDFeature_quals>
329          <INSDQualifier>
330            <INSDQualifier_name>gene</INSDQualifier_name>
331            <INSDQualifier_value>DAG1</INSDQualifier_value>
332          </INSDQualifier>
333          <INSDQualifier>
334            <INSDQualifier_name>number</INSDQualifier_name>
335            <INSDQualifier_value>1</INSDQualifier_value>
336          </INSDQualifier>
337        </INSDFeature_quals>
338      </INSDFeature>
339      <INSDFeature>
340        <INSDFeature_key>exon</INSDFeature_key>
341        <INSDFeature_location>2548..3052</INSDFeature_location>
342        <INSDFeature_intervals>
343          <INSDInterval>
344            <INSDInterval_from>2548</INSDInterval_from>
345            <INSDInterval_to>3052</INSDInterval_to>
346            <INSDInterval_iscomp>false</INSDInterval_iscomp>
347            <INSDInterval_interbp>false</INSDInterval_interbp>
348            <INSDInterval_accession>AJ224122</INSDInterval_accession>
349          </INSDInterval>
350          <INSDFeature_partial5>false</INSDFeature_partial5>
351          <INSDFeature_partial3>false</INSDFeature_partial3>
352        </INSDFeature_intervals>
353        <INSDFeature_quals>
354          <INSDQualifier>
355            <INSDQualifier_name>gene</INSDQualifier_name>
356            <INSDQualifier_value>DAG1</INSDQualifier_value>
357          </INSDQualifier>
358          <INSDQualifier>
359            <INSDQualifier_name>number</INSDQualifier_name>
360            <INSDQualifier_value>2</INSDQualifier_value>
361          </INSDQualifier>
362        </INSDFeature_quals>
363      </INSDFeature>
364      <INSDFeature>
365        <INSDFeature_key>intron</INSDFeature_key>
366        <INSDFeature_location>3053..3136</INSDFeature_location>
367        <INSDFeature_intervals>
368          <INSDInterval>
369            <INSDInterval_from>3053</INSDInterval_from>
370            <INSDInterval_to>3136</INSDInterval_to>
371            <INSDInterval_iscomp>false</INSDInterval_iscomp>
372            <INSDInterval_interbp>false</INSDInterval_interbp>
373            <INSDInterval_accession>AJ224122</INSDInterval_accession>
374          </INSDInterval>
375          <INSDFeature_partial5>false</INSDFeature_partial5>
376          <INSDFeature_partial3>false</INSDFeature_partial3>
377        </INSDFeature_intervals>
378        <INSDFeature_quals>
379          <INSDQualifier>
380            <INSDQualifier_name>gene</INSDQualifier_name>
381            <INSDQualifier_value>DAG1</INSDQualifier_value>
382          </INSDQualifier>
383          <INSDQualifier>
384            <INSDQualifier_name>number</INSDQualifier_name>
385            <INSDQualifier_value>2</INSDQualifier_value>
386          </INSDQualifier>
387        </INSDFeature_quals>
388      </INSDFeature>
389      <INSDFeature>
390        <INSDFeature_key>exon</INSDFeature_key>
391        <INSDFeature_location>3137..3495</INSDFeature_location>
392        <INSDFeature_intervals>
393          <INSDInterval>
394            <INSDInterval_from>3137</INSDInterval_from>
395            <INSDInterval_to>3495</INSDInterval_to>
396            <INSDInterval_iscomp>false</INSDInterval_iscomp>
397            <INSDInterval_interbp>false</INSDInterval_interbp>
398            <INSDInterval_accession>AJ224122</INSDInterval_accession>
399          </INSDInterval>
400          <INSDFeature_partial5>false</INSDFeature_partial5>
401          <INSDFeature_partial3>false</INSDFeature_partial3>
402        </INSDFeature_intervals>
403        <INSDFeature_quals>
404          <INSDQualifier>
405            <INSDQualifier_name>gene</INSDQualifier_name>
406            <INSDQualifier_value>DAG1</INSDQualifier_value>
407          </INSDQualifier>
408          <INSDQualifier>
409            <INSDQualifier_name>number</INSDQualifier_name>
410            <INSDQualifier_value>3</INSDQualifier_value>
411          </INSDQualifier>
412        </INSDFeature_quals>
413      </INSDFeature>
414    </INSDSeq_feature-table>
415    <INSDSeq_sequence>
416aattaaaacgccacgcaaggcgattctaggaaatcaaaacgacacgaaatgtggggtgggtgtttgggtaggaaagacag
417ttgtcaacatcagggatttggattgaatcaaaaaaaaagtccttagatttcataaaagctaatcacgcctcaaaactggg
418gcctatctcttcttttttgtcgcttcctgtcggtccttctctatttcttctccaacccctcatttttgaatatttacata
419acaaaccgttttactttctttggtcaaaattagacccaaaattctatattagtttaagatatgtggtctgtaatttattg
420ttgtattgatataaaaattagttataagcgattatatttttatgctcaagtaactggtgttagttaactatattccacca
421cgataacctgattacataaaatatgattttaatcattttagtaaaccatatcgcacgttggatgattaattttaacggtt
422taataacacgtgattaaattatttttagaatgattatttacaaacggaaaagctatatgtgacacaataactcgtgcagt
423attgttagtttgaaaagtgtatttggtttcttatatttggcctcgattttcagtttatgtgctttttacaaagttttatt
424ttcgttatctgtttaacgcgacatttgttgtatggctttaccgatttgagaataaaatcatattacctttatgtagccat
425gtgtggtgtaatatataataatggtccttctacgaaaaaagcagatcacaattgaaataaagggtgaaatttggtgtccc
426ttttcttcgtcgaaataacagaactaaataaaagaaagtgttatagtatattacgtccgaagaataatccatattcctga
427aatacagtcaacatattatatatttagtactttatataaagttaggaattaaatcatatgttttatcgaccatattaagt
428cacaactttatcataaattaatctgtaattagaattccaagttcgccaccgaatttcgtaacctaatctacatataatag
429ataaaatatatatatgtagagtaattatgatatctatgtatgtagtcatggtatatgaattttgaaattggcaaggtaac
430attgacggatcgtaacccaacaaataatattaattacaaaatgggtgggcgggaatagtatacaactcataattccactc
431actttttgtattattaggatatgaaataagagtaatcaacatgcataataaagatgtataatttcttcatcttaaaaaac
432ataactacatggtttaatacacaattttaccttttatcaaaaaagtatttcacaattcactcgcaaattacgaaatgatg
433gctagtgcttcaactccaaatttcgaatattttaaatcacgatgtgtagaaccttttatttactggatactaatcactag
434tttattgagccaaccaattagttaaatagaacaatcaatattatagccagatattttttcctttaaaaatatttaaaaga
435ggggccagaaaagaaccagagagggaggccatgagacattattatcactagtcaaaaacaacaaaccctccttttgcttt
436ttcatataaattattatattttattttgcaggtttcttctcttcttcttcttcttcttcttcttcttcctcttggctgct
437ttctttcatcatccataaagtgaaagctaacgcatagagagagccatatcgtcccaaaaaaagcaaaagtccaaaaaaaa
438acaactccaaaacattctctcttagctctttactctttagtttctctctctctctctgcctttctctttgttgaagttca
439tggatgctacgaagtggactcaggtacgtaaaaagatatctctctgctatatctgtttgtttgtagcttctccccgactc
440tcacgctctctctctctctctctctctctttgtgtatctctctactcacataaatatatacatgtgtgtgtatgcatgtt
441tatatgtatgtatgaaaccagtagtggttatacagatagtctatatagagatatcaatatgatgtgttttaatttagact
442ttttatatatccgtttgaaacttccgaagttctcgaatggagttaaggaagttttgttctctacaagttcaatttttctt
443gtcattaattataaaactctgataactaatggataaaaaaggtatgctttgttagttaccttttgttcttggtgctcagg
444tcttaccatttttttcctaaattttaattagtctcctttctttaattaattttatgttaacgcactgacgatttaacgtt
445aacaaaaaaacctagattctttttcttttcaatagagcataattattacttcaatttcatttatctcacactaaacccta
446atcttggcgaaattccttttatatatataaatttaattaatttttccacaatcttggcggaattcaggactcggttttgc
447ttgttattgttctctcttttaatttgacatggttagggaatacttaaagtatgtcttaattttatagggttttcaagaaa
448tgataaacgtaaagccaatggagcaaatgatttctagcaccaacaacaacacaccgcaacaacaaccaacattcatcgcc
449accaacacaaggccaaacgccaccgcatccaatggtggctccggaggaaataccaacaacacggctacgatggaaactag
450aaaggcgaggccacaagagaaagtaaattgtccaagatgcaactcaacaaacacaaagttctgttattacaacaactaca
451gtctcacgcaaccaagatacttctgcaaaggttgtcgaaggtattggaccgaaggtggctctcttcgtaacgtcccagtc
452ggaggtagctcaagaaagaacaagagatcctctacacctttagcttcaccttctaatcccaaacttccagatctaaaccc
453accgattcttttctcaagccaaatccctaataagtcaaataaagatctcaacttgctatctttcccggtcatgcaagatc
454atcatcatcatggtatgtctcatttttttcatatgcccaagatagagaacaacaatacttcatcctcaatctatgcttca
455tcatctcctgtctcagctcttgagcttctaagatccaatggagtctcttcaagaggcatgaacacgttcttgcctggtca
456aatgatggattcaaactcagtcctgtactcatctttagggtttccaacaatgcctgattacaaacagagtaataacaacc
457tttcattctccattgatcatcatcaagggattggacataacaccatcaacagtaaccaaagagctcaagataacaatgat
458gacatgaatggagcaagtagggttttgttccctttttcagacatgaaagagctttcaagcacaacccaagagaagagtca
459tggtaataatacatattggaatgggatgttcagtaatacaggaggatcttcatggtgaaaaaaggttaaaaagagctcat
460gaactatcagctttcttctctttttctgtttttttctcctattttattatagtttttactttgatgatcttttgtttttt
461ctcacatggggaactttacttaaagttgtcagaacttagtttacagattgtctttttattccttctttctggttttcctt
462ttttcctttttttatcagtctttttaaaatatgtatttcataattgggtttgatcattcatatttattagtatcaaaata
463gagtctatgttcatgagggagtgttaaggggtgtgagggtagaagaataagtgaatacgggggcccg
464    </INSDSeq_sequence>
465  </INSDSeq>
466</INSDSet>