OpenBio*: aj224122.embl

File aj224122.embl, 9.1 KB (added by markjschreiber, 10 years ago)

Correct version of EMBL file

Line 
1ID   AJ224122; SV 3; linear; genomic DNA; STD; PLN; 3827 BP.
2XX
3AC   AJ224122;
4XX
5DT   27-FEB-1998 (Rel. 54, Created)
6DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
7XX
8DE   Arabidopsis thaliana DAG1 gene
9XX
10KW   BBFa gene; transcription factor.
11XX
12OS   Arabidopsis thaliana (thale cress)
13OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
14OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
15OC   eurosids II; Brassicales; Brassicaceae; Arabidopsis.
16XX
17RN   [1]
18RC   revised by [3]
19RA   Vittorioso P.;
20RT   ;
21RL   Submitted (24-FEB-1998) to the EMBL/GenBank/DDBJ databases.
22RL   Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La
23RL   Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY.
24XX
25RN   [2]
26RX   PUBMED; 8771779.
27RA   De Paolis A., Sabatini S., De Pascalis L., Costantino P., Capone I.;
28RT   "A rolB regulatory factor belongs to a new class of single zinc finger
29RT   plant proteins";
30RL   Plant J. 10(2):215-223(1996).
31XX
32RN   [3]
33RC   revised by [4]
34RA   Vittorioso P.;
35RT   ;
36RL   Submitted (25-FEB-1999) to the EMBL/GenBank/DDBJ databases.
37RL   Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La
38RL   Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY.
39XX
40RN   [4]
41RP   1-3827
42RA   Vittorioso P.;
43RT   ;
44RL   Submitted (12-APR-2001) to the EMBL/GenBank/DDBJ databases.
45RL   Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La
46RL   Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY.
47XX
48RN   [5]
49RX   PUBMED; 10640273.
50RA   Papi M., Sabatini S., Bouchez D., Camilleri C., Costantino P.,
51RA   Vittorioso P.;
52RT   "Identification and disruption of an Arabidopsis zinc finger gene
53RT   controlling seed germination";
54RL   Genes Dev. 14(1):28-33(2000).
55XX
56FH   Key             Location/Qualifiers
57FH
58FT   source          1..3827
59FT                   /organism="Arabidopsis thaliana"
60FT                   /chromosome="3"
61FT                   /cultivar="Wassilewskija"
62FT                   /mol_type="genomic DNA"
63FT                   /db_xref="taxon:3702"
64FT   mRNA            join(1726..1863,2548..3052,3137..3827)
65FT                   /gene="DAG1"
66FT                   /product="DNA-binding protein"
67FT                   /function="transcription factor"
68FT                   /experiment="experimental evidence, no additional details
69FT                   recorded"
70FT   CDS             join(1840..1863,2548..3052,3137..3498)
71FT                   /gene="DAG1"
72FT                   /standard_name="BBFa"
73FT                   /product="DNA-binding protein"
74FT                   /function="transcription factor"
75FT                   /db_xref="GOA:Q43385"
76FT                   /db_xref="InterPro:IPR003851"
77FT                   /db_xref="UniProtKB/Swiss-Prot:Q43385"
78FT                   /experiment="experimental evidence, no additional details
79FT                   recorded"
80FT                   /protein_id="CAB40190.1"
81FT                   /translation="MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPN
82FT                   ATASNGGSGGNTNNTATMETRKARPQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGC
83FT                   RRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNKDLN
84FT                   LLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTMPDYKQSN
85FT                   NNLSFSIDHHQGIGHNTINSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEKSHGNN
86FT                   TYWNGMFSNTGGSSW"
87FT   exon            1726..1863
88FT                   /gene="DAG1"
89FT                   /number=1
90FT   intron          1864..2547
91FT                   /gene="DAG1"
92FT                   /number=1
93FT   exon            2548..3052
94FT                   /gene="DAG1"
95FT                   /number=2
96FT   intron          3053..3136
97FT                   /gene="DAG1"
98FT                   /number=2
99FT   exon            3137..3495
100FT                   /gene="DAG1"
101FT                   /number=3
102XX
103SQ   Sequence 3827 BP; 1216 A; 693 C; 590 G; 1328 T; 0 other;
104     aattaaaacg ccacgcaagg cgattctagg aaatcaaaac gacacgaaat gtggggtggg        60
105     tgtttgggta ggaaagacag ttgtcaacat cagggatttg gattgaatca aaaaaaaagt       120
106     ccttagattt cataaaagct aatcacgcct caaaactggg gcctatctct tcttttttgt       180
107     cgcttcctgt cggtccttct ctatttcttc tccaacccct catttttgaa tatttacata       240
108     acaaaccgtt ttactttctt tggtcaaaat tagacccaaa attctatatt agtttaagat       300
109     atgtggtctg taatttattg ttgtattgat ataaaaatta gttataagcg attatatttt       360
110     tatgctcaag taactggtgt tagttaacta tattccacca cgataacctg attacataaa       420
111     atatgatttt aatcatttta gtaaaccata tcgcacgttg gatgattaat tttaacggtt       480
112     taataacacg tgattaaatt atttttagaa tgattattta caaacggaaa agctatatgt       540
113     gacacaataa ctcgtgcagt attgttagtt tgaaaagtgt atttggtttc ttatatttgg       600
114     cctcgatttt cagtttatgt gctttttaca aagttttatt ttcgttatct gtttaacgcg       660
115     acatttgttg tatggcttta ccgatttgag aataaaatca tattaccttt atgtagccat       720
116     gtgtggtgta atatataata atggtccttc tacgaaaaaa gcagatcaca attgaaataa       780
117     agggtgaaat ttggtgtccc ttttcttcgt cgaaataaca gaactaaata aaagaaagtg       840
118     ttatagtata ttacgtccga agaataatcc atattcctga aatacagtca acatattata       900
119     tatttagtac tttatataaa gttaggaatt aaatcatatg ttttatcgac catattaagt       960
120     cacaacttta tcataaatta atctgtaatt agaattccaa gttcgccacc gaatttcgta      1020
121     acctaatcta catataatag ataaaatata tatatgtaga gtaattatga tatctatgta      1080
122     tgtagtcatg gtatatgaat tttgaaattg gcaaggtaac attgacggat cgtaacccaa      1140
123     caaataatat taattacaaa atgggtgggc gggaatagta tacaactcat aattccactc      1200
124     actttttgta ttattaggat atgaaataag agtaatcaac atgcataata aagatgtata      1260
125     atttcttcat cttaaaaaac ataactacat ggtttaatac acaattttac cttttatcaa      1320
126     aaaagtattt cacaattcac tcgcaaatta cgaaatgatg gctagtgctt caactccaaa      1380
127     tttcgaatat tttaaatcac gatgtgtaga accttttatt tactggatac taatcactag      1440
128     tttattgagc caaccaatta gttaaataga acaatcaata ttatagccag atattttttc      1500
129     ctttaaaaat atttaaaaga ggggccagaa aagaaccaga gagggaggcc atgagacatt      1560
130     attatcacta gtcaaaaaca acaaaccctc cttttgcttt ttcatataaa ttattatatt      1620
131     ttattttgca ggtttcttct cttcttcttc ttcttcttct tcttcttcct cttggctgct      1680
132     ttctttcatc atccataaag tgaaagctaa cgcatagaga gagccatatc gtcccaaaaa      1740
133     aagcaaaagt ccaaaaaaaa acaactccaa aacattctct cttagctctt tactctttag      1800
134     tttctctctc tctctctgcc tttctctttg ttgaagttca tggatgctac gaagtggact      1860
135     caggtacgta aaaagatatc tctctgctat atctgtttgt ttgtagcttc tccccgactc      1920
136     tcacgctctc tctctctctc tctctctctt tgtgtatctc tctactcaca taaatatata      1980
137     catgtgtgtg tatgcatgtt tatatgtatg tatgaaacca gtagtggtta tacagatagt      2040
138     ctatatagag atatcaatat gatgtgtttt aatttagact ttttatatat ccgtttgaaa      2100
139     cttccgaagt tctcgaatgg agttaaggaa gttttgttct ctacaagttc aatttttctt      2160
140     gtcattaatt ataaaactct gataactaat ggataaaaaa ggtatgcttt gttagttacc      2220
141     ttttgttctt ggtgctcagg tcttaccatt tttttcctaa attttaatta gtctcctttc      2280
142     tttaattaat tttatgttaa cgcactgacg atttaacgtt aacaaaaaaa cctagattct      2340
143     ttttcttttc aatagagcat aattattact tcaatttcat ttatctcaca ctaaacccta      2400
144     atcttggcga aattcctttt atatatataa atttaattaa tttttccaca atcttggcgg      2460
145     aattcaggac tcggttttgc ttgttattgt tctctctttt aatttgacat ggttagggaa      2520
146     tacttaaagt atgtcttaat tttatagggt tttcaagaaa tgataaacgt aaagccaatg      2580
147     gagcaaatga tttctagcac caacaacaac acaccgcaac aacaaccaac attcatcgcc      2640
148     accaacacaa ggccaaacgc caccgcatcc aatggtggct ccggaggaaa taccaacaac      2700
149     acggctacga tggaaactag aaaggcgagg ccacaagaga aagtaaattg tccaagatgc      2760
150     aactcaacaa acacaaagtt ctgttattac aacaactaca gtctcacgca accaagatac      2820
151     ttctgcaaag gttgtcgaag gtattggacc gaaggtggct ctcttcgtaa cgtcccagtc      2880
152     ggaggtagct caagaaagaa caagagatcc tctacacctt tagcttcacc ttctaatccc      2940
153     aaacttccag atctaaaccc accgattctt ttctcaagcc aaatccctaa taagtcaaat      3000
154     aaagatctca acttgctatc tttcccggtc atgcaagatc atcatcatca tggtatgtct      3060
155     catttttttc atatgcccaa gatagagaac aacaatactt catcctcaat ctatgcttca      3120
156     tcatctcctg tctcagctct tgagcttcta agatccaatg gagtctcttc aagaggcatg      3180
157     aacacgttct tgcctggtca aatgatggat tcaaactcag tcctgtactc atctttaggg      3240
158     tttccaacaa tgcctgatta caaacagagt aataacaacc tttcattctc cattgatcat      3300
159     catcaaggga ttggacataa caccatcaac agtaaccaaa gagctcaaga taacaatgat      3360
160     gacatgaatg gagcaagtag ggttttgttc cctttttcag acatgaaaga gctttcaagc      3420
161     acaacccaag agaagagtca tggtaataat acatattgga atgggatgtt cagtaataca      3480
162     ggaggatctt catggtgaaa aaaggttaaa aagagctcat gaactatcag ctttcttctc      3540
163     tttttctgtt tttttctcct attttattat agtttttact ttgatgatct tttgtttttt      3600
164     ctcacatggg gaactttact taaagttgtc agaacttagt ttacagattg tctttttatt      3660
165     ccttctttct ggttttcctt ttttcctttt tttatcagtc tttttaaaat atgtatttca      3720
166     taattgggtt tgatcattca tatttattag tatcaaaata gagtctatgt tcatgaggga      3780
167     gtgttaaggg gtgtgagggt agaagaataa gtgaatacgg gggcccg                    3827
168//