OpenBio*: aj224122.gb

File aj224122.gb, 8.9 KB (added by jan.aerts, 11 years ago)

AJ224122 in genbank format as downloaded from NCBI

Line 
1LOCUS       AJ224122                3827 bp    DNA     linear   PLN 14-NOV-2006
2DEFINITION  Arabidopsis thaliana DAG1 gene.
3ACCESSION   AJ224122
4VERSION     AJ224122.3  GI:13938851
5KEYWORDS    BBFa gene; transcription factor.
6SOURCE      Arabidopsis thaliana (thale cress)
7  ORGANISM  Arabidopsis thaliana
8            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
9            Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons;
10            rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis.
11REFERENCE   1
12  AUTHORS   De Paolis,A., Sabatini,S., De Pascalis,L., Costantino,P. and
13            Capone,I.
14  TITLE     A rolB regulatory factor belongs to a new class of single zinc
15            finger plant proteins
16  JOURNAL   Plant J. 10 (2), 215-223 (1996)
17   PUBMED   8771779
18REFERENCE   2
19  AUTHORS   Papi,M., Sabatini,S., Bouchez,D., Camilleri,C., Costantino,P. and
20            Vittorioso,P.
21  TITLE     Identification and disruption of an Arabidopsis zinc finger gene
22            controlling seed germination
23  JOURNAL   Genes Dev. 14 (1), 28-33 (2000)
24   PUBMED   10640273
25REFERENCE   3
26  AUTHORS   Vittorioso,P.
27  TITLE     Direct Submission
28  JOURNAL   Submitted (24-FEB-1998) Vittorioso P., Dip. Genetica e Biologia
29            Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;,
30            00185 Rome, ITALY
31  REMARK    revised by [3]
32REFERENCE   4
33  AUTHORS   Vittorioso,P.
34  TITLE     Direct Submission
35  JOURNAL   Submitted (25-FEB-1999) Vittorioso P., Dip. Genetica e Biologia
36            Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;,
37            00185 Rome, ITALY
38  REMARK    revised by [4]
39REFERENCE   5  (bases 1 to 3827)
40  AUTHORS   Vittorioso,P.
41  TITLE     Direct Submission
42  JOURNAL   Submitted (12-APR-2001) Vittorioso P., Dip. Genetica e Biologia
43            Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5;,
44            00185 Rome, ITALY
45COMMENT     On May 3, 2001 this sequence version replaced gi:4469119.
46FEATURES             Location/Qualifiers
47     source          1..3827
48                     /organism="Arabidopsis thaliana"
49                     /mol_type="genomic DNA"
50                     /cultivar="Wassilewskija"
51                     /db_xref="taxon:3702"
52                     /chromosome="3"
53                     /ecotype="Wassilewskija"
54     gene            1726..3827
55                     /gene="DAG1"
56     mRNA            join(1726..1863,2548..3052,3137..3827)
57                     /gene="DAG1"
58                     /product="DNA-binding protein"
59                     /experiment="experimental evidence, no additional details
60                     recorded"
61                     /function="transcription factor"
62     exon            1726..1863
63                     /gene="DAG1"
64                     /number=1
65     CDS             join(1840..1863,2548..3052,3137..3498)
66                     /gene="DAG1"
67                     /function="transcription factor"
68                     /standard_name="BBFa"
69                     /experiment="experimental evidence, no additional details
70                     recorded"
71                     /codon_start=1
72                     /product="DNA-binding protein"
73                     /protein_id="CAB40190.1"
74                     /db_xref="GI:4581965"
75                     /db_xref="GOA:Q43385"
76                     /db_xref="InterPro:IPR003851"
77                     /db_xref="UniProtKB/Swiss-Prot:Q43385"
78                     /translation="MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRP
79                     NATASNGGSGGNTNNTATMETRKARPQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCK
80                     GCRRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNK
81                     DLNLLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTMPDY
82                     KQSNNNLSFSIDHHQGIGHNTINSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEK
83                     SHGNNTYWNGMFSNTGGSSW"
84     intron          1864..2547
85                     /gene="DAG1"
86                     /number=1
87     exon            2548..3052
88                     /gene="DAG1"
89                     /number=2
90     intron          3053..3136
91                     /gene="DAG1"
92                     /number=2
93     exon            3137..3495
94                     /gene="DAG1"
95                     /number=3
96ORIGIN     
97        1 aattaaaacg ccacgcaagg cgattctagg aaatcaaaac gacacgaaat gtggggtggg
98       61 tgtttgggta ggaaagacag ttgtcaacat cagggatttg gattgaatca aaaaaaaagt
99      121 ccttagattt cataaaagct aatcacgcct caaaactggg gcctatctct tcttttttgt
100      181 cgcttcctgt cggtccttct ctatttcttc tccaacccct catttttgaa tatttacata
101      241 acaaaccgtt ttactttctt tggtcaaaat tagacccaaa attctatatt agtttaagat
102      301 atgtggtctg taatttattg ttgtattgat ataaaaatta gttataagcg attatatttt
103      361 tatgctcaag taactggtgt tagttaacta tattccacca cgataacctg attacataaa
104      421 atatgatttt aatcatttta gtaaaccata tcgcacgttg gatgattaat tttaacggtt
105      481 taataacacg tgattaaatt atttttagaa tgattattta caaacggaaa agctatatgt
106      541 gacacaataa ctcgtgcagt attgttagtt tgaaaagtgt atttggtttc ttatatttgg
107      601 cctcgatttt cagtttatgt gctttttaca aagttttatt ttcgttatct gtttaacgcg
108      661 acatttgttg tatggcttta ccgatttgag aataaaatca tattaccttt atgtagccat
109      721 gtgtggtgta atatataata atggtccttc tacgaaaaaa gcagatcaca attgaaataa
110      781 agggtgaaat ttggtgtccc ttttcttcgt cgaaataaca gaactaaata aaagaaagtg
111      841 ttatagtata ttacgtccga agaataatcc atattcctga aatacagtca acatattata
112      901 tatttagtac tttatataaa gttaggaatt aaatcatatg ttttatcgac catattaagt
113      961 cacaacttta tcataaatta atctgtaatt agaattccaa gttcgccacc gaatttcgta
114     1021 acctaatcta catataatag ataaaatata tatatgtaga gtaattatga tatctatgta
115     1081 tgtagtcatg gtatatgaat tttgaaattg gcaaggtaac attgacggat cgtaacccaa
116     1141 caaataatat taattacaaa atgggtgggc gggaatagta tacaactcat aattccactc
117     1201 actttttgta ttattaggat atgaaataag agtaatcaac atgcataata aagatgtata
118     1261 atttcttcat cttaaaaaac ataactacat ggtttaatac acaattttac cttttatcaa
119     1321 aaaagtattt cacaattcac tcgcaaatta cgaaatgatg gctagtgctt caactccaaa
120     1381 tttcgaatat tttaaatcac gatgtgtaga accttttatt tactggatac taatcactag
121     1441 tttattgagc caaccaatta gttaaataga acaatcaata ttatagccag atattttttc
122     1501 ctttaaaaat atttaaaaga ggggccagaa aagaaccaga gagggaggcc atgagacatt
123     1561 attatcacta gtcaaaaaca acaaaccctc cttttgcttt ttcatataaa ttattatatt
124     1621 ttattttgca ggtttcttct cttcttcttc ttcttcttct tcttcttcct cttggctgct
125     1681 ttctttcatc atccataaag tgaaagctaa cgcatagaga gagccatatc gtcccaaaaa
126     1741 aagcaaaagt ccaaaaaaaa acaactccaa aacattctct cttagctctt tactctttag
127     1801 tttctctctc tctctctgcc tttctctttg ttgaagttca tggatgctac gaagtggact
128     1861 caggtacgta aaaagatatc tctctgctat atctgtttgt ttgtagcttc tccccgactc
129     1921 tcacgctctc tctctctctc tctctctctt tgtgtatctc tctactcaca taaatatata
130     1981 catgtgtgtg tatgcatgtt tatatgtatg tatgaaacca gtagtggtta tacagatagt
131     2041 ctatatagag atatcaatat gatgtgtttt aatttagact ttttatatat ccgtttgaaa
132     2101 cttccgaagt tctcgaatgg agttaaggaa gttttgttct ctacaagttc aatttttctt
133     2161 gtcattaatt ataaaactct gataactaat ggataaaaaa ggtatgcttt gttagttacc
134     2221 ttttgttctt ggtgctcagg tcttaccatt tttttcctaa attttaatta gtctcctttc
135     2281 tttaattaat tttatgttaa cgcactgacg atttaacgtt aacaaaaaaa cctagattct
136     2341 ttttcttttc aatagagcat aattattact tcaatttcat ttatctcaca ctaaacccta
137     2401 atcttggcga aattcctttt atatatataa atttaattaa tttttccaca atcttggcgg
138     2461 aattcaggac tcggttttgc ttgttattgt tctctctttt aatttgacat ggttagggaa
139     2521 tacttaaagt atgtcttaat tttatagggt tttcaagaaa tgataaacgt aaagccaatg
140     2581 gagcaaatga tttctagcac caacaacaac acaccgcaac aacaaccaac attcatcgcc
141     2641 accaacacaa ggccaaacgc caccgcatcc aatggtggct ccggaggaaa taccaacaac
142     2701 acggctacga tggaaactag aaaggcgagg ccacaagaga aagtaaattg tccaagatgc
143     2761 aactcaacaa acacaaagtt ctgttattac aacaactaca gtctcacgca accaagatac
144     2821 ttctgcaaag gttgtcgaag gtattggacc gaaggtggct ctcttcgtaa cgtcccagtc
145     2881 ggaggtagct caagaaagaa caagagatcc tctacacctt tagcttcacc ttctaatccc
146     2941 aaacttccag atctaaaccc accgattctt ttctcaagcc aaatccctaa taagtcaaat
147     3001 aaagatctca acttgctatc tttcccggtc atgcaagatc atcatcatca tggtatgtct
148     3061 catttttttc atatgcccaa gatagagaac aacaatactt catcctcaat ctatgcttca
149     3121 tcatctcctg tctcagctct tgagcttcta agatccaatg gagtctcttc aagaggcatg
150     3181 aacacgttct tgcctggtca aatgatggat tcaaactcag tcctgtactc atctttaggg
151     3241 tttccaacaa tgcctgatta caaacagagt aataacaacc tttcattctc cattgatcat
152     3301 catcaaggga ttggacataa caccatcaac agtaaccaaa gagctcaaga taacaatgat
153     3361 gacatgaatg gagcaagtag ggttttgttc cctttttcag acatgaaaga gctttcaagc
154     3421 acaacccaag agaagagtca tggtaataat acatattgga atgggatgtt cagtaataca
155     3481 ggaggatctt catggtgaaa aaaggttaaa aagagctcat gaactatcag ctttcttctc
156     3541 tttttctgtt tttttctcct attttattat agtttttact ttgatgatct tttgtttttt
157     3601 ctcacatggg gaactttact taaagttgtc agaacttagt ttacagattg tctttttatt
158     3661 ccttctttct ggttttcctt ttttcctttt tttatcagtc tttttaaaat atgtatttca
159     3721 taattgggtt tgatcattca tatttattag tatcaaaata gagtctatgt tcatgaggga
160     3781 gtgttaaggg gtgtgagggt agaagaataa gtgaatacgg gggcccg
161//
162