OpenBio*: aj224122.gb_xml

File aj224122.gb_xml, 68.3 KB (added by jan.aerts, 10 years ago)

AJ224122 in genbank XML format as downloaded from NCBI

Line 
1<?xml version="1.0"?>
2<!DOCTYPE Bioseq-set PUBLIC "-//NCBI//NCBI Seqset/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_Seqset.dtd">
3<Bioseq-set>
4<Bioseq-set_seq-set>
5<Seq-entry>
6  <Seq-entry_set>
7    <Bioseq-set>
8      <Bioseq-set_level>1</Bioseq-set_level>
9      <Bioseq-set_class value="nuc-prot"/>
10      <Bioseq-set_descr>
11        <Seq-descr>
12          <Seqdesc>
13            <Seqdesc_pub>
14              <Pubdesc>
15                <Pubdesc_pub>
16                  <Pub-equiv>
17                    <Pub>
18                      <Pub_sub>
19                        <Cit-sub>
20                          <Cit-sub_authors>
21                            <Auth-list>
22                              <Auth-list_names>
23                                <Auth-list_names_std>
24                                  <Author>
25                                    <Author_name>
26                                      <Person-id>
27                                        <Person-id_name>
28                                          <Name-std>
29                                            <Name-std_last>Vittorioso</Name-std_last>
30                                            <Name-std_initials>P.</Name-std_initials>
31                                          </Name-std>
32                                        </Person-id_name>
33                                      </Person-id>
34                                    </Author_name>
35                                  </Author>
36                                </Auth-list_names_std>
37                              </Auth-list_names>
38                              <Auth-list_affil>
39                                <Affil>
40                                  <Affil_str>Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY</Affil_str>
41                                </Affil>
42                              </Auth-list_affil>
43                            </Auth-list>
44                          </Cit-sub_authors>
45                          <Cit-sub_medium value="other"/>
46                          <Cit-sub_date>
47                            <Date>
48                              <Date_std>
49                                <Date-std>
50                                  <Date-std_year>1998</Date-std_year>
51                                  <Date-std_month>2</Date-std_month>
52                                  <Date-std_day>24</Date-std_day>
53                                </Date-std>
54                              </Date_std>
55                            </Date>
56                          </Cit-sub_date>
57                        </Cit-sub>
58                      </Pub_sub>
59                    </Pub>
60                  </Pub-equiv>
61                </Pubdesc_pub>
62                <Pubdesc_comment>revised by [3]</Pubdesc_comment>
63                <Pubdesc_reftype value="no-target">3</Pubdesc_reftype>
64              </Pubdesc>
65            </Seqdesc_pub>
66          </Seqdesc>
67          <Seqdesc>
68            <Seqdesc_pub>
69              <Pubdesc>
70                <Pubdesc_pub>
71                  <Pub-equiv>
72                    <Pub>
73                      <Pub_pmid>
74                        <PubMedId>8771779</PubMedId>
75                      </Pub_pmid>
76                    </Pub>
77                    <Pub>
78                      <Pub_article>
79                        <Cit-art>
80                          <Cit-art_title>
81                            <Title>
82                              <Title_E>
83                                <Title_E_name>A rolB regulatory factor belongs to a new class of single zinc finger plant proteins.</Title_E_name>
84                              </Title_E>
85                            </Title>
86                          </Cit-art_title>
87                          <Cit-art_authors>
88                            <Auth-list>
89                              <Auth-list_names>
90                                <Auth-list_names_std>
91                                  <Author>
92                                    <Author_name>
93                                      <Person-id>
94                                        <Person-id_name>
95                                          <Name-std>
96                                            <Name-std_last>De Paolis</Name-std_last>
97                                            <Name-std_initials>A.</Name-std_initials>
98                                          </Name-std>
99                                        </Person-id_name>
100                                      </Person-id>
101                                    </Author_name>
102                                  </Author>
103                                  <Author>
104                                    <Author_name>
105                                      <Person-id>
106                                        <Person-id_name>
107                                          <Name-std>
108                                            <Name-std_last>Sabatini</Name-std_last>
109                                            <Name-std_initials>S.</Name-std_initials>
110                                          </Name-std>
111                                        </Person-id_name>
112                                      </Person-id>
113                                    </Author_name>
114                                  </Author>
115                                  <Author>
116                                    <Author_name>
117                                      <Person-id>
118                                        <Person-id_name>
119                                          <Name-std>
120                                            <Name-std_last>De Pascalis</Name-std_last>
121                                            <Name-std_initials>L.</Name-std_initials>
122                                          </Name-std>
123                                        </Person-id_name>
124                                      </Person-id>
125                                    </Author_name>
126                                  </Author>
127                                  <Author>
128                                    <Author_name>
129                                      <Person-id>
130                                        <Person-id_name>
131                                          <Name-std>
132                                            <Name-std_last>Costantino</Name-std_last>
133                                            <Name-std_initials>P.</Name-std_initials>
134                                          </Name-std>
135                                        </Person-id_name>
136                                      </Person-id>
137                                    </Author_name>
138                                  </Author>
139                                  <Author>
140                                    <Author_name>
141                                      <Person-id>
142                                        <Person-id_name>
143                                          <Name-std>
144                                            <Name-std_last>Capone</Name-std_last>
145                                            <Name-std_initials>I.</Name-std_initials>
146                                          </Name-std>
147                                        </Person-id_name>
148                                      </Person-id>
149                                    </Author_name>
150                                  </Author>
151                                </Auth-list_names_std>
152                              </Auth-list_names>
153                              <Auth-list_affil>
154                                <Affil>
155                                  <Affil_str>Istituto Pasteur Fondazione Cenci Bolognetti, Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, Italy.</Affil_str>
156                                </Affil>
157                              </Auth-list_affil>
158                            </Auth-list>
159                          </Cit-art_authors>
160                          <Cit-art_from>
161                            <Cit-art_from_journal>
162                              <Cit-jour>
163                                <Cit-jour_title>
164                                  <Title>
165                                    <Title_E>
166                                      <Title_E_iso-jta>Plant J.</Title_E_iso-jta>
167                                    </Title_E>
168                                    <Title_E>
169                                      <Title_E_ml-jta>Plant J</Title_E_ml-jta>
170                                    </Title_E>
171                                    <Title_E>
172                                      <Title_E_issn>0960-7412</Title_E_issn>
173                                    </Title_E>
174                                    <Title_E>
175                                      <Title_E_name>The Plant journal : for cell and molecular biology</Title_E_name>
176                                    </Title_E>
177                                  </Title>
178                                </Cit-jour_title>
179                                <Cit-jour_imp>
180                                  <Imprint>
181                                    <Imprint_date>
182                                      <Date>
183                                        <Date_std>
184                                          <Date-std>
185                                            <Date-std_year>1996</Date-std_year>
186                                            <Date-std_month>8</Date-std_month>
187                                          </Date-std>
188                                        </Date_std>
189                                      </Date>
190                                    </Imprint_date>
191                                    <Imprint_volume>10</Imprint_volume>
192                                    <Imprint_issue>2</Imprint_issue>
193                                    <Imprint_pages>215-223</Imprint_pages>
194                                    <Imprint_language>eng</Imprint_language>
195                                    <Imprint_pubstatus>
196                                      <PubStatus value="ppublish">4</PubStatus>
197                                    </Imprint_pubstatus>
198                                    <Imprint_history>
199                                      <PubStatusDateSet>
200                                        <PubStatusDate>
201                                          <PubStatusDate_pubstatus>
202                                            <PubStatus value="pubmed">8</PubStatus>
203                                          </PubStatusDate_pubstatus>
204                                          <PubStatusDate_date>
205                                            <Date>
206                                              <Date_std>
207                                                <Date-std>
208                                                  <Date-std_year>1996</Date-std_year>
209                                                  <Date-std_month>8</Date-std_month>
210                                                  <Date-std_day>1</Date-std_day>
211                                                </Date-std>
212                                              </Date_std>
213                                            </Date>
214                                          </PubStatusDate_date>
215                                        </PubStatusDate>
216                                        <PubStatusDate>
217                                          <PubStatusDate_pubstatus>
218                                            <PubStatus value="medline">12</PubStatus>
219                                          </PubStatusDate_pubstatus>
220                                          <PubStatusDate_date>
221                                            <Date>
222                                              <Date_std>
223                                                <Date-std>
224                                                  <Date-std_year>1996</Date-std_year>
225                                                  <Date-std_month>8</Date-std_month>
226                                                  <Date-std_day>1</Date-std_day>
227                                                  <Date-std_hour>0</Date-std_hour>
228                                                  <Date-std_minute>1</Date-std_minute>
229                                                </Date-std>
230                                              </Date_std>
231                                            </Date>
232                                          </PubStatusDate_date>
233                                        </PubStatusDate>
234                                      </PubStatusDateSet>
235                                    </Imprint_history>
236                                  </Imprint>
237                                </Cit-jour_imp>
238                              </Cit-jour>
239                            </Cit-art_from_journal>
240                          </Cit-art_from>
241                          <Cit-art_ids>
242                            <ArticleIdSet>
243                              <ArticleId>
244                                <ArticleId_pubmed>
245                                  <PubMedId>8771779</PubMedId>
246                                </ArticleId_pubmed>
247                              </ArticleId>
248                            </ArticleIdSet>
249                          </Cit-art_ids>
250                        </Cit-art>
251                      </Pub_article>
252                    </Pub>
253                  </Pub-equiv>
254                </Pubdesc_pub>
255                <Pubdesc_reftype value="no-target">3</Pubdesc_reftype>
256              </Pubdesc>
257            </Seqdesc_pub>
258          </Seqdesc>
259          <Seqdesc>
260            <Seqdesc_pub>
261              <Pubdesc>
262                <Pubdesc_pub>
263                  <Pub-equiv>
264                    <Pub>
265                      <Pub_sub>
266                        <Cit-sub>
267                          <Cit-sub_authors>
268                            <Auth-list>
269                              <Auth-list_names>
270                                <Auth-list_names_std>
271                                  <Author>
272                                    <Author_name>
273                                      <Person-id>
274                                        <Person-id_name>
275                                          <Name-std>
276                                            <Name-std_last>Vittorioso</Name-std_last>
277                                            <Name-std_initials>P.</Name-std_initials>
278                                          </Name-std>
279                                        </Person-id_name>
280                                      </Person-id>
281                                    </Author_name>
282                                  </Author>
283                                </Auth-list_names_std>
284                              </Auth-list_names>
285                              <Auth-list_affil>
286                                <Affil>
287                                  <Affil_str>Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY</Affil_str>
288                                </Affil>
289                              </Auth-list_affil>
290                            </Auth-list>
291                          </Cit-sub_authors>
292                          <Cit-sub_medium value="other"/>
293                          <Cit-sub_date>
294                            <Date>
295                              <Date_std>
296                                <Date-std>
297                                  <Date-std_year>1999</Date-std_year>
298                                  <Date-std_month>2</Date-std_month>
299                                  <Date-std_day>25</Date-std_day>
300                                </Date-std>
301                              </Date_std>
302                            </Date>
303                          </Cit-sub_date>
304                        </Cit-sub>
305                      </Pub_sub>
306                    </Pub>
307                  </Pub-equiv>
308                </Pubdesc_pub>
309                <Pubdesc_comment>revised by [4]</Pubdesc_comment>
310                <Pubdesc_reftype value="no-target">3</Pubdesc_reftype>
311              </Pubdesc>
312            </Seqdesc_pub>
313          </Seqdesc>
314          <Seqdesc>
315            <Seqdesc_pub>
316              <Pubdesc>
317                <Pubdesc_pub>
318                  <Pub-equiv>
319                    <Pub>
320                      <Pub_sub>
321                        <Cit-sub>
322                          <Cit-sub_authors>
323                            <Auth-list>
324                              <Auth-list_names>
325                                <Auth-list_names_std>
326                                  <Author>
327                                    <Author_name>
328                                      <Person-id>
329                                        <Person-id_name>
330                                          <Name-std>
331                                            <Name-std_last>Vittorioso</Name-std_last>
332                                            <Name-std_initials>P.</Name-std_initials>
333                                          </Name-std>
334                                        </Person-id_name>
335                                      </Person-id>
336                                    </Author_name>
337                                  </Author>
338                                </Auth-list_names_std>
339                              </Auth-list_names>
340                              <Auth-list_affil>
341                                <Affil>
342                                  <Affil_str>Vittorioso P., Dip. Genetica e Biologia Molecolare, Universita di Roma La Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY</Affil_str>
343                                </Affil>
344                              </Auth-list_affil>
345                            </Auth-list>
346                          </Cit-sub_authors>
347                          <Cit-sub_medium value="other"/>
348                          <Cit-sub_date>
349                            <Date>
350                              <Date_std>
351                                <Date-std>
352                                  <Date-std_year>2001</Date-std_year>
353                                  <Date-std_month>4</Date-std_month>
354                                  <Date-std_day>12</Date-std_day>
355                                </Date-std>
356                              </Date_std>
357                            </Date>
358                          </Cit-sub_date>
359                        </Cit-sub>
360                      </Pub_sub>
361                    </Pub>
362                  </Pub-equiv>
363                </Pubdesc_pub>
364              </Pubdesc>
365            </Seqdesc_pub>
366          </Seqdesc>
367          <Seqdesc>
368            <Seqdesc_pub>
369              <Pubdesc>
370                <Pubdesc_pub>
371                  <Pub-equiv>
372                    <Pub>
373                      <Pub_pmid>
374                        <PubMedId>10640273</PubMedId>
375                      </Pub_pmid>
376                    </Pub>
377                    <Pub>
378                      <Pub_article>
379                        <Cit-art>
380                          <Cit-art_title>
381                            <Title>
382                              <Title_E>
383                                <Title_E_name>Identification and disruption of an Arabidopsis zinc finger gene controlling seed germination.</Title_E_name>
384                              </Title_E>
385                            </Title>
386                          </Cit-art_title>
387                          <Cit-art_authors>
388                            <Auth-list>
389                              <Auth-list_names>
390                                <Auth-list_names_std>
391                                  <Author>
392                                    <Author_name>
393                                      <Person-id>
394                                        <Person-id_name>
395                                          <Name-std>
396                                            <Name-std_last>Papi</Name-std_last>
397                                            <Name-std_initials>M.</Name-std_initials>
398                                          </Name-std>
399                                        </Person-id_name>
400                                      </Person-id>
401                                    </Author_name>
402                                  </Author>
403                                  <Author>
404                                    <Author_name>
405                                      <Person-id>
406                                        <Person-id_name>
407                                          <Name-std>
408                                            <Name-std_last>Sabatini</Name-std_last>
409                                            <Name-std_initials>S.</Name-std_initials>
410                                          </Name-std>
411                                        </Person-id_name>
412                                      </Person-id>
413                                    </Author_name>
414                                  </Author>
415                                  <Author>
416                                    <Author_name>
417                                      <Person-id>
418                                        <Person-id_name>
419                                          <Name-std>
420                                            <Name-std_last>Bouchez</Name-std_last>
421                                            <Name-std_initials>D.</Name-std_initials>
422                                          </Name-std>
423                                        </Person-id_name>
424                                      </Person-id>
425                                    </Author_name>
426                                  </Author>
427                                  <Author>
428                                    <Author_name>
429                                      <Person-id>
430                                        <Person-id_name>
431                                          <Name-std>
432                                            <Name-std_last>Camilleri</Name-std_last>
433                                            <Name-std_initials>C.</Name-std_initials>
434                                          </Name-std>
435                                        </Person-id_name>
436                                      </Person-id>
437                                    </Author_name>
438                                  </Author>
439                                  <Author>
440                                    <Author_name>
441                                      <Person-id>
442                                        <Person-id_name>
443                                          <Name-std>
444                                            <Name-std_last>Costantino</Name-std_last>
445                                            <Name-std_initials>P.</Name-std_initials>
446                                          </Name-std>
447                                        </Person-id_name>
448                                      </Person-id>
449                                    </Author_name>
450                                  </Author>
451                                  <Author>
452                                    <Author_name>
453                                      <Person-id>
454                                        <Person-id_name>
455                                          <Name-std>
456                                            <Name-std_last>Vittorioso</Name-std_last>
457                                            <Name-std_initials>P.</Name-std_initials>
458                                          </Name-std>
459                                        </Person-id_name>
460                                      </Person-id>
461                                    </Author_name>
462                                  </Author>
463                                </Auth-list_names_std>
464                              </Auth-list_names>
465                              <Auth-list_affil>
466                                <Affil>
467                                  <Affil_str>Istituto Pasteur Fondazione Cenci Bolognetti, Dipartimento di Genetica e Biologia Molecolare, Universit inverted question marka &quot;La Sapienza,&quot; 00185 Rome, Italy.</Affil_str>
468                                </Affil>
469                              </Auth-list_affil>
470                            </Auth-list>
471                          </Cit-art_authors>
472                          <Cit-art_from>
473                            <Cit-art_from_journal>
474                              <Cit-jour>
475                                <Cit-jour_title>
476                                  <Title>
477                                    <Title_E>
478                                      <Title_E_iso-jta>Genes Dev.</Title_E_iso-jta>
479                                    </Title_E>
480                                    <Title_E>
481                                      <Title_E_ml-jta>Genes Dev</Title_E_ml-jta>
482                                    </Title_E>
483                                    <Title_E>
484                                      <Title_E_issn>0890-9369</Title_E_issn>
485                                    </Title_E>
486                                    <Title_E>
487                                      <Title_E_name>Genes &amp; development</Title_E_name>
488                                    </Title_E>
489                                  </Title>
490                                </Cit-jour_title>
491                                <Cit-jour_imp>
492                                  <Imprint>
493                                    <Imprint_date>
494                                      <Date>
495                                        <Date_std>
496                                          <Date-std>
497                                            <Date-std_year>2000</Date-std_year>
498                                            <Date-std_month>1</Date-std_month>
499                                            <Date-std_day>1</Date-std_day>
500                                          </Date-std>
501                                        </Date_std>
502                                      </Date>
503                                    </Imprint_date>
504                                    <Imprint_volume>14</Imprint_volume>
505                                    <Imprint_issue>1</Imprint_issue>
506                                    <Imprint_pages>28-33</Imprint_pages>
507                                    <Imprint_language>eng</Imprint_language>
508                                    <Imprint_pubstatus>
509                                      <PubStatus value="ppublish">4</PubStatus>
510                                    </Imprint_pubstatus>
511                                    <Imprint_history>
512                                      <PubStatusDateSet>
513                                        <PubStatusDate>
514                                          <PubStatusDate_pubstatus>
515                                            <PubStatus value="pubmed">8</PubStatus>
516                                          </PubStatusDate_pubstatus>
517                                          <PubStatusDate_date>
518                                            <Date>
519                                              <Date_std>
520                                                <Date-std>
521                                                  <Date-std_year>2000</Date-std_year>
522                                                  <Date-std_month>1</Date-std_month>
523                                                  <Date-std_day>20</Date-std_day>
524                                                  <Date-std_hour>9</Date-std_hour>
525                                                  <Date-std_minute>0</Date-std_minute>
526                                                </Date-std>
527                                              </Date_std>
528                                            </Date>
529                                          </PubStatusDate_date>
530                                        </PubStatusDate>
531                                        <PubStatusDate>
532                                          <PubStatusDate_pubstatus>
533                                            <PubStatus value="medline">12</PubStatus>
534                                          </PubStatusDate_pubstatus>
535                                          <PubStatusDate_date>
536                                            <Date>
537                                              <Date_std>
538                                                <Date-std>
539                                                  <Date-std_year>2000</Date-std_year>
540                                                  <Date-std_month>2</Date-std_month>
541                                                  <Date-std_day>19</Date-std_day>
542                                                  <Date-std_hour>9</Date-std_hour>
543                                                  <Date-std_minute>0</Date-std_minute>
544                                                </Date-std>
545                                              </Date_std>
546                                            </Date>
547                                          </PubStatusDate_date>
548                                        </PubStatusDate>
549                                      </PubStatusDateSet>
550                                    </Imprint_history>
551                                  </Imprint>
552                                </Cit-jour_imp>
553                              </Cit-jour>
554                            </Cit-art_from_journal>
555                          </Cit-art_from>
556                          <Cit-art_ids>
557                            <ArticleIdSet>
558                              <ArticleId>
559                                <ArticleId_pubmed>
560                                  <PubMedId>10640273</PubMedId>
561                                </ArticleId_pubmed>
562                              </ArticleId>
563                            </ArticleIdSet>
564                          </Cit-art_ids>
565                        </Cit-art>
566                      </Pub_article>
567                    </Pub>
568                  </Pub-equiv>
569                </Pubdesc_pub>
570                <Pubdesc_reftype value="no-target">3</Pubdesc_reftype>
571              </Pubdesc>
572            </Seqdesc_pub>
573          </Seqdesc>
574          <Seqdesc>
575            <Seqdesc_update-date>
576              <Date>
577                <Date_std>
578                  <Date-std>
579                    <Date-std_year>2006</Date-std_year>
580                    <Date-std_month>11</Date-std_month>
581                    <Date-std_day>14</Date-std_day>
582                  </Date-std>
583                </Date_std>
584              </Date>
585            </Seqdesc_update-date>
586          </Seqdesc>
587          <Seqdesc>
588            <Seqdesc_source>
589              <BioSource>
590                <BioSource_org>
591                  <Org-ref>
592                    <Org-ref_taxname>Arabidopsis thaliana</Org-ref_taxname>
593                    <Org-ref_common>thale cress</Org-ref_common>
594                    <Org-ref_db>
595                      <Dbtag>
596                        <Dbtag_db>taxon</Dbtag_db>
597                        <Dbtag_tag>
598                          <Object-id>
599                            <Object-id_id>3702</Object-id_id>
600                          </Object-id>
601                        </Dbtag_tag>
602                      </Dbtag>
603                    </Org-ref_db>
604                    <Org-ref_orgname>
605                      <OrgName>
606                        <OrgName_name>
607                          <OrgName_name_binomial>
608                            <BinomialOrgName>
609                              <BinomialOrgName_genus>Arabidopsis</BinomialOrgName_genus>
610                              <BinomialOrgName_species>thaliana</BinomialOrgName_species>
611                            </BinomialOrgName>
612                          </OrgName_name_binomial>
613                        </OrgName_name>
614                        <OrgName_mod>
615                          <OrgMod>
616                            <OrgMod_subtype value="cultivar">10</OrgMod_subtype>
617                            <OrgMod_subname>Wassilewskija</OrgMod_subname>
618                          </OrgMod>
619                          <OrgMod>
620                            <OrgMod_subtype value="ecotype">27</OrgMod_subtype>
621                            <OrgMod_subname>Wassilewskija</OrgMod_subname>
622                          </OrgMod>
623                          <OrgMod>
624                            <OrgMod_subtype value="old-name">254</OrgMod_subtype>
625                            <OrgMod_subname>Arabidopsis thaliana</OrgMod_subname>
626                            <OrgMod_attrib>(10)cultivar=Wassilewskija</OrgMod_attrib>
627                          </OrgMod>
628                        </OrgName_mod>
629                        <OrgName_lineage>Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis</OrgName_lineage>
630                        <OrgName_gcode>1</OrgName_gcode>
631                        <OrgName_mgcode>1</OrgName_mgcode>
632                        <OrgName_div>PLN</OrgName_div>
633                      </OrgName>
634                    </Org-ref_orgname>
635                  </Org-ref>
636                </BioSource_org>
637                <BioSource_subtype>
638                  <SubSource>
639                    <SubSource_subtype value="chromosome">1</SubSource_subtype>
640                    <SubSource_name>3</SubSource_name>
641                  </SubSource>
642                </BioSource_subtype>
643              </BioSource>
644            </Seqdesc_source>
645          </Seqdesc>
646          <Seqdesc>
647            <Seqdesc_create-date>
648              <Date>
649                <Date_std>
650                  <Date-std>
651                    <Date-std_year>1998</Date-std_year>
652                    <Date-std_month>2</Date-std_month>
653                    <Date-std_day>27</Date-std_day>
654                  </Date-std>
655                </Date_std>
656              </Date>
657            </Seqdesc_create-date>
658          </Seqdesc>
659        </Seq-descr>
660      </Bioseq-set_descr>
661      <Bioseq-set_seq-set>
662        <Seq-entry>
663          <Seq-entry_seq>
664            <Bioseq>
665              <Bioseq_id>
666                <Seq-id>
667                  <Seq-id_embl>
668                    <Textseq-id>
669                      <Textseq-id_accession>AJ224122</Textseq-id_accession>
670                      <Textseq-id_version>3</Textseq-id_version>
671                    </Textseq-id>
672                  </Seq-id_embl>
673                </Seq-id>
674                <Seq-id>
675                  <Seq-id_gi>13938851</Seq-id_gi>
676                </Seq-id>
677              </Bioseq_id>
678              <Bioseq_descr>
679                <Seq-descr>
680                  <Seqdesc>
681                    <Seqdesc_title>Arabidopsis thaliana DAG1 gene</Seqdesc_title>
682                  </Seqdesc>
683                  <Seqdesc>
684                    <Seqdesc_embl>
685                      <EMBL-block>
686                        <EMBL-block_div value="pln"/>
687                        <EMBL-block_creation-date>
688                          <Date>
689                            <Date_std>
690                              <Date-std>
691                                <Date-std_year>1998</Date-std_year>
692                                <Date-std_month>2</Date-std_month>
693                                <Date-std_day>27</Date-std_day>
694                              </Date-std>
695                            </Date_std>
696                          </Date>
697                        </EMBL-block_creation-date>
698                        <EMBL-block_update-date>
699                          <Date>
700                            <Date_std>
701                              <Date-std>
702                                <Date-std_year>2006</Date-std_year>
703                                <Date-std_month>11</Date-std_month>
704                                <Date-std_day>14</Date-std_day>
705                              </Date-std>
706                            </Date_std>
707                          </Date>
708                        </EMBL-block_update-date>
709                        <EMBL-block_keywords>
710                          <EMBL-block_keywords_E>BBFa gene</EMBL-block_keywords_E>
711                          <EMBL-block_keywords_E>transcription factor</EMBL-block_keywords_E>
712                        </EMBL-block_keywords>
713                      </EMBL-block>
714                    </Seqdesc_embl>
715                  </Seqdesc>
716                  <Seqdesc>
717                    <Seqdesc_molinfo>
718                      <MolInfo>
719                        <MolInfo_biomol value="genomic">1</MolInfo_biomol>
720                      </MolInfo>
721                    </Seqdesc_molinfo>
722                  </Seqdesc>
723                </Seq-descr>
724              </Bioseq_descr>
725              <Bioseq_inst>
726                <Seq-inst>
727                  <Seq-inst_repr value="raw"/>
728                  <Seq-inst_mol value="dna"/>
729                  <Seq-inst_length>3827</Seq-inst_length>
730                  <Seq-inst_seq-data>
731                    <Seq-data>
732                      <Seq-data_iupacna>
733                        <IUPACna>AATTAAAACGCCACGCAAGGCGATTCTAGGAAATCAAAACGACACGAAATGTGGGGTGGGTGTTTGGGTAGGAAAGACAGTTGTCAACATCAGGGATTTGGATTGAATCAAAAAAAAAGTCCTTAGATTTCATAAAAGCTAATCACGCCTCAAAACTGGGGCCTATCTCTTCTTTTTTGTCGCTTCCTGTCGGTCCTTCTCTATTTCTTCTCCAACCCCTCATTTTTGAATATTTACATAACAAACCGTTTTACTTTCTTTGGTCAAAATTAGACCCAAAATTCTATATTAGTTTAAGATATGTGGTCTGTAATTTATTGTTGTATTGATATAAAAATTAGTTATAAGCGATTATATTTTTATGCTCAAGTAACTGGTGTTAGTTAACTATATTCCACCACGATAACCTGATTACATAAAATATGATTTTAATCATTTTAGTAAACCATATCGCACGTTGGATGATTAATTTTAACGGTTTAATAACACGTGATTAAATTATTTTTAGAATGATTATTTACAAACGGAAAAGCTATATGTGACACAATAACTCGTGCAGTATTGTTAGTTTGAAAAGTGTATTTGGTTTCTTATATTTGGCCTCGATTTTCAGTTTATGTGCTTTTTACAAAGTTTTATTTTCGTTATCTGTTTAACGCGACATTTGTTGTATGGCTTTACCGATTTGAGAATAAAATCATATTACCTTTATGTAGCCATGTGTGGTGTAATATATAATAATGGTCCTTCTACGAAAAAAGCAGATCACAATTGAAATAAAGGGTGAAATTTGGTGTCCCTTTTCTTCGTCGAAATAACAGAACTAAATAAAAGAAAGTGTTATAGTATATTACGTCCGAAGAATAATCCATATTCCTGAAATACAGTCAACATATTATATATTTAGTACTTTATATAAAGTTAGGAATTAAATCATATGTTTTATCGACCATATTAAGTCACAACTTTATCATAAATTAATCTGTAATTAGAATTCCAAGTTCGCCACCGAATTTCGTAACCTAATCTACATATAATAGATAAAATATATATATGTAGAGTAATTATGATATCTATGTATGTAGTCATGGTATATGAATTTTGAAATTGGCAAGGTAACATTGACGGATCGTAACCCAACAAATAATATTAATTACAAAATGGGTGGGCGGGAATAGTATACAACTCATAATTCCACTCACTTTTTGTATTATTAGGATATGAAATAAGAGTAATCAACATGCATAATAAAGATGTATAATTTCTTCATCTTAAAAAACATAACTACATGGTTTAATACACAATTTTACCTTTTATCAAAAAAGTATTTCACAATTCACTCGCAAATTACGAAATGATGGCTAGTGCTTCAACTCCAAATTTCGAATATTTTAAATCACGATGTGTAGAACCTTTTATTTACTGGATACTAATCACTAGTTTATTGAGCCAACCAATTAGTTAAATAGAACAATCAATATTATAGCCAGATATTTTTTCCTTTAAAAATATTTAAAAGAGGGGCCAGAAAAGAACCAGAGAGGGAGGCCATGAGACATTATTATCACTAGTCAAAAACAACAAACCCTCCTTTTGCTTTTTCATATAAATTATTATATTTTATTTTGCAGGTTTCTTCTCTTCTTCTTCTTCTTCTTCTTCTTCTTCCTCTTGGCTGCTTTCTTTCATCATCCATAAAGTGAAAGCTAACGCATAGAGAGAGCCATATCGTCCCAAAAAAAGCAAAAGTCCAAAAAAAAACAACTCCAAAACATTCTCTCTTAGCTCTTTACTCTTTAGTTTCTCTCTCTCTCTCTGCCTTTCTCTTTGTTGAAGTTCATGGATGCTACGAAGTGGACTCAGGTACGTAAAAAGATATCTCTCTGCTATATCTGTTTGTTTGTAGCTTCTCCCCGACTCTCACGCTCTCTCTCTCTCTCTCTCTCTCTTTGTGTATCTCTCTACTCACATAAATATATACATGTGTGTGTATGCATGTTTATATGTATGTATGAAACCAGTAGTGGTTATACAGATAGTCTATATAGAGATATCAATATGATGTGTTTTAATTTAGACTTTTTATATATCCGTTTGAAACTTCCGAAGTTCTCGAATGGAGTTAAGGAAGTTTTGTTCTCTACAAGTTCAATTTTTCTTGTCATTAATTATAAAACTCTGATAACTAATGGATAAAAAAGGTATGCTTTGTTAGTTACCTTTTGTTCTTGGTGCTCAGGTCTTACCATTTTTTTCCTAAATTTTAATTAGTCTCCTTTCTTTAATTAATTTTATGTTAACGCACTGACGATTTAACGTTAACAAAAAAACCTAGATTCTTTTTCTTTTCAATAGAGCATAATTATTACTTCAATTTCATTTATCTCACACTAAACCCTAATCTTGGCGAAATTCCTTTTATATATATAAATTTAATTAATTTTTCCACAATCTTGGCGGAATTCAGGACTCGGTTTTGCTTGTTATTGTTCTCTCTTTTAATTTGACATGGTTAGGGAATACTTAAAGTATGTCTTAATTTTATAGGGTTTTCAAGAAATGATAAACGTAAAGCCAATGGAGCAAATGATTTCTAGCACCAACAACAACACACCGCAACAACAACCAACATTCATCGCCACCAACACAAGGCCAAACGCCACCGCATCCAATGGTGGCTCCGGAGGAAATACCAACAACACGGCTACGATGGAAACTAGAAAGGCGAGGCCACAAGAGAAAGTAAATTGTCCAAGATGCAACTCAACAAACACAAAGTTCTGTTATTACAACAACTACAGTCTCACGCAACCAAGATACTTCTGCAAAGGTTGTCGAAGGTATTGGACCGAAGGTGGCTCTCTTCGTAACGTCCCAGTCGGAGGTAGCTCAAGAAAGAACAAGAGATCCTCTACACCTTTAGCTTCACCTTCTAATCCCAAACTTCCAGATCTAAACCCACCGATTCTTTTCTCAAGCCAAATCCCTAATAAGTCAAATAAAGATCTCAACTTGCTATCTTTCCCGGTCATGCAAGATCATCATCATCATGGTATGTCTCATTTTTTTCATATGCCCAAGATAGAGAACAACAATACTTCATCCTCAATCTATGCTTCATCATCTCCTGTCTCAGCTCTTGAGCTTCTAAGATCCAATGGAGTCTCTTCAAGAGGCATGAACACGTTCTTGCCTGGTCAAATGATGGATTCAAACTCAGTCCTGTACTCATCTTTAGGGTTTCCAACAATGCCTGATTACAAACAGAGTAATAACAACCTTTCATTCTCCATTGATCATCATCAAGGGATTGGACATAACACCATCAACAGTAACCAAAGAGCTCAAGATAACAATGATGACATGAATGGAGCAAGTAGGGTTTTGTTCCCTTTTTCAGACATGAAAGAGCTTTCAAGCACAACCCAAGAGAAGAGTCATGGTAATAATACATATTGGAATGGGATGTTCAGTAATACAGGAGGATCTTCATGGTGAAAAAAGGTTAAAAAGAGCTCATGAACTATCAGCTTTCTTCTCTTTTTCTGTTTTTTTCTCCTATTTTATTATAGTTTTTACTTTGATGATCTTTTGTTTTTTCTCACATGGGGAACTTTACTTAAAGTTGTCAGAACTTAGTTTACAGATTGTCTTTTTATTCCTTCTTTCTGGTTTTCCTTTTTTCCTTTTTTTATCAGTCTTTTTAAAATATGTATTTCATAATTGGGTTTGATCATTCATATTTATTAGTATCAAAATAGAGTCTATGTTCATGAGGGAGTGTTAAGGGGTGTGAGGGTAGAAGAATAAGTGAATACGGGGGCCCG</IUPACna>
734                      </Seq-data_iupacna>
735                    </Seq-data>
736                  </Seq-inst_seq-data>
737                  <Seq-inst_hist>
738                    <Seq-hist>
739                      <Seq-hist_replaces>
740                        <Seq-hist-rec>
741                          <Seq-hist-rec_date>
742                            <Date>
743                              <Date_std>
744                                <Date-std>
745                                  <Date-std_year>2001</Date-std_year>
746                                  <Date-std_month>5</Date-std_month>
747                                  <Date-std_day>3</Date-std_day>
748                                </Date-std>
749                              </Date_std>
750                            </Date>
751                          </Seq-hist-rec_date>
752                          <Seq-hist-rec_ids>
753                            <Seq-id>
754                              <Seq-id_gi>4469119</Seq-id_gi>
755                            </Seq-id>
756                          </Seq-hist-rec_ids>
757                        </Seq-hist-rec>
758                      </Seq-hist_replaces>
759                    </Seq-hist>
760                  </Seq-inst_hist>
761                </Seq-inst>
762              </Bioseq_inst>
763              <Bioseq_annot>
764                <Seq-annot>
765                  <Seq-annot_data>
766                    <Seq-annot_data_ftable>
767                      <Seq-feat>
768                        <Seq-feat_data>
769                          <SeqFeatData>
770                            <SeqFeatData_rna>
771                              <RNA-ref>
772                                <RNA-ref_type value="mRNA"/>
773                                <RNA-ref_ext>
774                                  <RNA-ref_ext_name>DNA-binding protein</RNA-ref_ext_name>
775                                </RNA-ref_ext>
776                              </RNA-ref>
777                            </SeqFeatData_rna>
778                          </SeqFeatData>
779                        </Seq-feat_data>
780                        <Seq-feat_location>
781                          <Seq-loc>
782                            <Seq-loc_mix>
783                              <Seq-loc-mix>
784                                <Seq-loc>
785                                  <Seq-loc_int>
786                                    <Seq-interval>
787                                      <Seq-interval_from>1725</Seq-interval_from>
788                                      <Seq-interval_to>1862</Seq-interval_to>
789                                      <Seq-interval_id>
790                                        <Seq-id>
791                                          <Seq-id_gi>13938851</Seq-id_gi>
792                                        </Seq-id>
793                                      </Seq-interval_id>
794                                    </Seq-interval>
795                                  </Seq-loc_int>
796                                </Seq-loc>
797                                <Seq-loc>
798                                  <Seq-loc_int>
799                                    <Seq-interval>
800                                      <Seq-interval_from>2547</Seq-interval_from>
801                                      <Seq-interval_to>3051</Seq-interval_to>
802                                      <Seq-interval_id>
803                                        <Seq-id>
804                                          <Seq-id_gi>13938851</Seq-id_gi>
805                                        </Seq-id>
806                                      </Seq-interval_id>
807                                    </Seq-interval>
808                                  </Seq-loc_int>
809                                </Seq-loc>
810                                <Seq-loc>
811                                  <Seq-loc_int>
812                                    <Seq-interval>
813                                      <Seq-interval_from>3136</Seq-interval_from>
814                                      <Seq-interval_to>3826</Seq-interval_to>
815                                      <Seq-interval_id>
816                                        <Seq-id>
817                                          <Seq-id_gi>13938851</Seq-id_gi>
818                                        </Seq-id>
819                                      </Seq-interval_id>
820                                    </Seq-interval>
821                                  </Seq-loc_int>
822                                </Seq-loc>
823                              </Seq-loc-mix>
824                            </Seq-loc_mix>
825                          </Seq-loc>
826                        </Seq-feat_location>
827                        <Seq-feat_qual>
828                          <Gb-qual>
829                            <Gb-qual_qual>experiment</Gb-qual_qual>
830                            <Gb-qual_val>experimental evidence, no additional details recorded</Gb-qual_val>
831                          </Gb-qual>
832                          <Gb-qual>
833                            <Gb-qual_qual>function</Gb-qual_qual>
834                            <Gb-qual_val>transcription factor</Gb-qual_val>
835                          </Gb-qual>
836                        </Seq-feat_qual>
837                        <Seq-feat_exp-ev value="experimental"/>
838                      </Seq-feat>
839                      <Seq-feat>
840                        <Seq-feat_data>
841                          <SeqFeatData>
842                            <SeqFeatData_imp>
843                              <Imp-feat>
844                                <Imp-feat_key>exon</Imp-feat_key>
845                              </Imp-feat>
846                            </SeqFeatData_imp>
847                          </SeqFeatData>
848                        </Seq-feat_data>
849                        <Seq-feat_location>
850                          <Seq-loc>
851                            <Seq-loc_int>
852                              <Seq-interval>
853                                <Seq-interval_from>1725</Seq-interval_from>
854                                <Seq-interval_to>1862</Seq-interval_to>
855                                <Seq-interval_id>
856                                  <Seq-id>
857                                    <Seq-id_gi>13938851</Seq-id_gi>
858                                  </Seq-id>
859                                </Seq-interval_id>
860                              </Seq-interval>
861                            </Seq-loc_int>
862                          </Seq-loc>
863                        </Seq-feat_location>
864                        <Seq-feat_qual>
865                          <Gb-qual>
866                            <Gb-qual_qual>number</Gb-qual_qual>
867                            <Gb-qual_val>1</Gb-qual_val>
868                          </Gb-qual>
869                        </Seq-feat_qual>
870                      </Seq-feat>
871                      <Seq-feat>
872                        <Seq-feat_data>
873                          <SeqFeatData>
874                            <SeqFeatData_imp>
875                              <Imp-feat>
876                                <Imp-feat_key>intron</Imp-feat_key>
877                              </Imp-feat>
878                            </SeqFeatData_imp>
879                          </SeqFeatData>
880                        </Seq-feat_data>
881                        <Seq-feat_location>
882                          <Seq-loc>
883                            <Seq-loc_int>
884                              <Seq-interval>
885                                <Seq-interval_from>1863</Seq-interval_from>
886                                <Seq-interval_to>2546</Seq-interval_to>
887                                <Seq-interval_id>
888                                  <Seq-id>
889                                    <Seq-id_gi>13938851</Seq-id_gi>
890                                  </Seq-id>
891                                </Seq-interval_id>
892                              </Seq-interval>
893                            </Seq-loc_int>
894                          </Seq-loc>
895                        </Seq-feat_location>
896                        <Seq-feat_qual>
897                          <Gb-qual>
898                            <Gb-qual_qual>number</Gb-qual_qual>
899                            <Gb-qual_val>1</Gb-qual_val>
900                          </Gb-qual>
901                        </Seq-feat_qual>
902                      </Seq-feat>
903                      <Seq-feat>
904                        <Seq-feat_data>
905                          <SeqFeatData>
906                            <SeqFeatData_imp>
907                              <Imp-feat>
908                                <Imp-feat_key>exon</Imp-feat_key>
909                              </Imp-feat>
910                            </SeqFeatData_imp>
911                          </SeqFeatData>
912                        </Seq-feat_data>
913                        <Seq-feat_location>
914                          <Seq-loc>
915                            <Seq-loc_int>
916                              <Seq-interval>
917                                <Seq-interval_from>2547</Seq-interval_from>
918                                <Seq-interval_to>3051</Seq-interval_to>
919                                <Seq-interval_id>
920                                  <Seq-id>
921                                    <Seq-id_gi>13938851</Seq-id_gi>
922                                  </Seq-id>
923                                </Seq-interval_id>
924                              </Seq-interval>
925                            </Seq-loc_int>
926                          </Seq-loc>
927                        </Seq-feat_location>
928                        <Seq-feat_qual>
929                          <Gb-qual>
930                            <Gb-qual_qual>number</Gb-qual_qual>
931                            <Gb-qual_val>2</Gb-qual_val>
932                          </Gb-qual>
933                        </Seq-feat_qual>
934                      </Seq-feat>
935                      <Seq-feat>
936                        <Seq-feat_data>
937                          <SeqFeatData>
938                            <SeqFeatData_imp>
939                              <Imp-feat>
940                                <Imp-feat_key>intron</Imp-feat_key>
941                              </Imp-feat>
942                            </SeqFeatData_imp>
943                          </SeqFeatData>
944                        </Seq-feat_data>
945                        <Seq-feat_location>
946                          <Seq-loc>
947                            <Seq-loc_int>
948                              <Seq-interval>
949                                <Seq-interval_from>3052</Seq-interval_from>
950                                <Seq-interval_to>3135</Seq-interval_to>
951                                <Seq-interval_id>
952                                  <Seq-id>
953                                    <Seq-id_gi>13938851</Seq-id_gi>
954                                  </Seq-id>
955                                </Seq-interval_id>
956                              </Seq-interval>
957                            </Seq-loc_int>
958                          </Seq-loc>
959                        </Seq-feat_location>
960                        <Seq-feat_qual>
961                          <Gb-qual>
962                            <Gb-qual_qual>number</Gb-qual_qual>
963                            <Gb-qual_val>2</Gb-qual_val>
964                          </Gb-qual>
965                        </Seq-feat_qual>
966                      </Seq-feat>
967                      <Seq-feat>
968                        <Seq-feat_data>
969                          <SeqFeatData>
970                            <SeqFeatData_imp>
971                              <Imp-feat>
972                                <Imp-feat_key>exon</Imp-feat_key>
973                              </Imp-feat>
974                            </SeqFeatData_imp>
975                          </SeqFeatData>
976                        </Seq-feat_data>
977                        <Seq-feat_location>
978                          <Seq-loc>
979                            <Seq-loc_int>
980                              <Seq-interval>
981                                <Seq-interval_from>3136</Seq-interval_from>
982                                <Seq-interval_to>3494</Seq-interval_to>
983                                <Seq-interval_id>
984                                  <Seq-id>
985                                    <Seq-id_gi>13938851</Seq-id_gi>
986                                  </Seq-id>
987                                </Seq-interval_id>
988                              </Seq-interval>
989                            </Seq-loc_int>
990                          </Seq-loc>
991                        </Seq-feat_location>
992                        <Seq-feat_qual>
993                          <Gb-qual>
994                            <Gb-qual_qual>number</Gb-qual_qual>
995                            <Gb-qual_val>3</Gb-qual_val>
996                          </Gb-qual>
997                        </Seq-feat_qual>
998                      </Seq-feat>
999                      <Seq-feat>
1000                        <Seq-feat_data>
1001                          <SeqFeatData>
1002                            <SeqFeatData_gene>
1003                              <Gene-ref>
1004                                <Gene-ref_locus>DAG1</Gene-ref_locus>
1005                              </Gene-ref>
1006                            </SeqFeatData_gene>
1007                          </SeqFeatData>
1008                        </Seq-feat_data>
1009                        <Seq-feat_location>
1010                          <Seq-loc>
1011                            <Seq-loc_int>
1012                              <Seq-interval>
1013                                <Seq-interval_from>1725</Seq-interval_from>
1014                                <Seq-interval_to>3826</Seq-interval_to>
1015                                <Seq-interval_id>
1016                                  <Seq-id>
1017                                    <Seq-id_gi>13938851</Seq-id_gi>
1018                                  </Seq-id>
1019                                </Seq-interval_id>
1020                              </Seq-interval>
1021                            </Seq-loc_int>
1022                          </Seq-loc>
1023                        </Seq-feat_location>
1024                      </Seq-feat>
1025                    </Seq-annot_data_ftable>
1026                  </Seq-annot_data>
1027                </Seq-annot>
1028              </Bioseq_annot>
1029            </Bioseq>
1030          </Seq-entry_seq>
1031        </Seq-entry>
1032        <Seq-entry>
1033          <Seq-entry_seq>
1034            <Bioseq>
1035              <Bioseq_id>
1036                <Seq-id>
1037                  <Seq-id_embl>
1038                    <Textseq-id>
1039                      <Textseq-id_accession>CAB40190</Textseq-id_accession>
1040                      <Textseq-id_version>1</Textseq-id_version>
1041                    </Textseq-id>
1042                  </Seq-id_embl>
1043                </Seq-id>
1044                <Seq-id>
1045                  <Seq-id_gi>4581965</Seq-id_gi>
1046                </Seq-id>
1047              </Bioseq_id>
1048              <Bioseq_descr>
1049                <Seq-descr>
1050                  <Seqdesc>
1051                    <Seqdesc_title>DNA-binding protein [Arabidopsis thaliana]</Seqdesc_title>
1052                  </Seqdesc>
1053                  <Seqdesc>
1054                    <Seqdesc_molinfo>
1055                      <MolInfo>
1056                        <MolInfo_biomol value="peptide">8</MolInfo_biomol>
1057                      </MolInfo>
1058                    </Seqdesc_molinfo>
1059                  </Seqdesc>
1060                </Seq-descr>
1061              </Bioseq_descr>
1062              <Bioseq_inst>
1063                <Seq-inst>
1064                  <Seq-inst_repr value="raw"/>
1065                  <Seq-inst_mol value="aa"/>
1066                  <Seq-inst_length>296</Seq-inst_length>
1067                  <Seq-inst_seq-data>
1068                    <Seq-data>
1069                      <Seq-data_iupacaa>
1070                        <IUPACaa>MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPNATASNGGSGGNTNNTATMETRKARPQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPSNPKLPDLNPPILFSSQIPNKSNKDLNLLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTMPDYKQSNNNLSFSIDHHQGIGHNTINSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEKSHGNNTYWNGMFSNTGGSSW</IUPACaa>
1071                      </Seq-data_iupacaa>
1072                    </Seq-data>
1073                  </Seq-inst_seq-data>
1074                </Seq-inst>
1075              </Bioseq_inst>
1076              <Bioseq_annot>
1077                <Seq-annot>
1078                  <Seq-annot_data>
1079                    <Seq-annot_data_ftable>
1080                      <Seq-feat>
1081                        <Seq-feat_data>
1082                          <SeqFeatData>
1083                            <SeqFeatData_prot>
1084                              <Prot-ref>
1085                                <Prot-ref_name>
1086                                  <Prot-ref_name_E>DNA-binding protein</Prot-ref_name_E>
1087                                </Prot-ref_name>
1088                                <Prot-ref_activity>
1089                                  <Prot-ref_activity_E>transcription factor</Prot-ref_activity_E>
1090                                </Prot-ref_activity>
1091                              </Prot-ref>
1092                            </SeqFeatData_prot>
1093                          </SeqFeatData>
1094                        </Seq-feat_data>
1095                        <Seq-feat_location>
1096                          <Seq-loc>
1097                            <Seq-loc_int>
1098                              <Seq-interval>
1099                                <Seq-interval_from>0</Seq-interval_from>
1100                                <Seq-interval_to>295</Seq-interval_to>
1101                                <Seq-interval_id>
1102                                  <Seq-id>
1103                                    <Seq-id_gi>4581965</Seq-id_gi>
1104                                  </Seq-id>
1105                                </Seq-interval_id>
1106                              </Seq-interval>
1107                            </Seq-loc_int>
1108                          </Seq-loc>
1109                        </Seq-feat_location>
1110                      </Seq-feat>
1111                    </Seq-annot_data_ftable>
1112                  </Seq-annot_data>
1113                </Seq-annot>
1114                <Seq-annot>
1115                  <Seq-annot_db value="other">255</Seq-annot_db>
1116                  <Seq-annot_name>Annot:CDD</Seq-annot_name>
1117                  <Seq-annot_desc>
1118                    <Annot-descr>
1119                      <Annotdesc>
1120                        <Annotdesc_name>CDDSearch</Annotdesc_name>
1121                      </Annotdesc>
1122                      <Annotdesc>
1123                        <Annotdesc_create-date>
1124                          <Date>
1125                            <Date_std>
1126                              <Date-std>
1127                                <Date-std_year>2007</Date-std_year>
1128                                <Date-std_month>10</Date-std_month>
1129                                <Date-std_day>26</Date-std_day>
1130                                <Date-std_hour>3</Date-std_hour>
1131                                <Date-std_minute>4</Date-std_minute>
1132                                <Date-std_second>27</Date-std_second>
1133                              </Date-std>
1134                            </Date_std>
1135                          </Date>
1136                        </Annotdesc_create-date>
1137                      </Annotdesc>
1138                    </Annot-descr>
1139                  </Seq-annot_desc>
1140                  <Seq-annot_data>
1141                    <Seq-annot_data_ftable>
1142                      <Seq-feat>
1143                        <Seq-feat_data>
1144                          <SeqFeatData>
1145                            <SeqFeatData_region>zf-Dof</SeqFeatData_region>
1146                          </SeqFeatData>
1147                        </Seq-feat_data>
1148                        <Seq-feat_comment>Dof domain, zinc finger. The Dof domain is a zinc finger DNA-binding domain, that shows resemblance to the Cys2 zinc finger.</Seq-feat_comment>
1149                        <Seq-feat_location>
1150                          <Seq-loc>
1151                            <Seq-loc_int>
1152                              <Seq-interval>
1153                                <Seq-interval_from>68</Seq-interval_from>
1154                                <Seq-interval_to>130</Seq-interval_to>
1155                                <Seq-interval_id>
1156                                  <Seq-id>
1157                                    <Seq-id_gi>4581965</Seq-id_gi>
1158                                  </Seq-id>
1159                                </Seq-interval_id>
1160                              </Seq-interval>
1161                            </Seq-loc_int>
1162                          </Seq-loc>
1163                        </Seq-feat_location>
1164                        <Seq-feat_ext>
1165                          <User-object>
1166                            <User-object_type>
1167                              <Object-id>
1168                                <Object-id_str>cddScoreData</Object-id_str>
1169                              </Object-id>
1170                            </User-object_type>
1171                            <User-object_data>
1172                              <User-field>
1173                                <User-field_label>
1174                                  <Object-id>
1175                                    <Object-id_str>definition</Object-id_str>
1176                                  </Object-id>
1177                                </User-field_label>
1178                                <User-field_data>
1179                                  <User-field_data_str>pfam02701</User-field_data_str>
1180                                </User-field_data>
1181                              </User-field>
1182                              <User-field>
1183                                <User-field_label>
1184                                  <Object-id>
1185                                    <Object-id_str>short_name</Object-id_str>
1186                                  </Object-id>
1187                                </User-field_label>
1188                                <User-field_data>
1189                                  <User-field_data_str>zf-Dof</User-field_data_str>
1190                                </User-field_data>
1191                              </User-field>
1192                              <User-field>
1193                                <User-field_label>
1194                                  <Object-id>
1195                                    <Object-id_str>score</Object-id_str>
1196                                  </Object-id>
1197                                </User-field_label>
1198                                <User-field_data>
1199                                  <User-field_data_int>297</User-field_data_int>
1200                                </User-field_data>
1201                              </User-field>
1202                              <User-field>
1203                                <User-field_label>
1204                                  <Object-id>
1205                                    <Object-id_str>evalue</Object-id_str>
1206                                  </Object-id>
1207                                </User-field_label>
1208                                <User-field_data>
1209                                  <User-field_data_real>1.48043e-27</User-field_data_real>
1210                                </User-field_data>
1211                              </User-field>
1212                              <User-field>
1213                                <User-field_label>
1214                                  <Object-id>
1215                                    <Object-id_str>bit_score</Object-id_str>
1216                                  </Object-id>
1217                                </User-field_label>
1218                                <User-field_data>
1219                                  <User-field_data_real>118.522</User-field_data_real>
1220                                </User-field_data>
1221                              </User-field>
1222                            </User-object_data>
1223                          </User-object>
1224                        </Seq-feat_ext>
1225                        <Seq-feat_dbxref>
1226                          <Dbtag>
1227                            <Dbtag_db>CDD</Dbtag_db>
1228                            <Dbtag_tag>
1229                              <Object-id>
1230                                <Object-id_id>66392</Object-id_id>
1231                              </Object-id>
1232                            </Dbtag_tag>
1233                          </Dbtag>
1234                        </Seq-feat_dbxref>
1235                      </Seq-feat>
1236                    </Seq-annot_data_ftable>
1237                  </Seq-annot_data>
1238                </Seq-annot>
1239              </Bioseq_annot>
1240            </Bioseq>
1241          </Seq-entry_seq>
1242        </Seq-entry>
1243      </Bioseq-set_seq-set>
1244      <Bioseq-set_annot>
1245        <Seq-annot>
1246          <Seq-annot_data>
1247            <Seq-annot_data_ftable>
1248              <Seq-feat>
1249                <Seq-feat_data>
1250                  <SeqFeatData>
1251                    <SeqFeatData_cdregion>
1252                      <Cdregion>
1253                        <Cdregion_frame value="one"/>
1254                        <Cdregion_code>
1255                          <Genetic-code>
1256                            <Genetic-code_E>
1257                              <Genetic-code_E_id>1</Genetic-code_E_id>
1258                            </Genetic-code_E>
1259                          </Genetic-code>
1260                        </Cdregion_code>
1261                      </Cdregion>
1262                    </SeqFeatData_cdregion>
1263                  </SeqFeatData>
1264                </Seq-feat_data>
1265                <Seq-feat_product>
1266                  <Seq-loc>
1267                    <Seq-loc_whole>
1268                      <Seq-id>
1269                        <Seq-id_gi>4581965</Seq-id_gi>
1270                      </Seq-id>
1271                    </Seq-loc_whole>
1272                  </Seq-loc>
1273                </Seq-feat_product>
1274                <Seq-feat_location>
1275                  <Seq-loc>
1276                    <Seq-loc_mix>
1277                      <Seq-loc-mix>
1278                        <Seq-loc>
1279                          <Seq-loc_int>
1280                            <Seq-interval>
1281                              <Seq-interval_from>1839</Seq-interval_from>
1282                              <Seq-interval_to>1862</Seq-interval_to>
1283                              <Seq-interval_id>
1284                                <Seq-id>
1285                                  <Seq-id_gi>13938851</Seq-id_gi>
1286                                </Seq-id>
1287                              </Seq-interval_id>
1288                            </Seq-interval>
1289                          </Seq-loc_int>
1290                        </Seq-loc>
1291                        <Seq-loc>
1292                          <Seq-loc_int>
1293                            <Seq-interval>
1294                              <Seq-interval_from>2547</Seq-interval_from>
1295                              <Seq-interval_to>3051</Seq-interval_to>
1296                              <Seq-interval_id>
1297                                <Seq-id>
1298                                  <Seq-id_gi>13938851</Seq-id_gi>
1299                                </Seq-id>
1300                              </Seq-interval_id>
1301                            </Seq-interval>
1302                          </Seq-loc_int>
1303                        </Seq-loc>
1304                        <Seq-loc>
1305                          <Seq-loc_int>
1306                            <Seq-interval>
1307                              <Seq-interval_from>3136</Seq-interval_from>
1308                              <Seq-interval_to>3497</Seq-interval_to>
1309                              <Seq-interval_id>
1310                                <Seq-id>
1311                                  <Seq-id_gi>13938851</Seq-id_gi>
1312                                </Seq-id>
1313                              </Seq-interval_id>
1314                            </Seq-interval>
1315                          </Seq-loc_int>
1316                        </Seq-loc>
1317                      </Seq-loc-mix>
1318                    </Seq-loc_mix>
1319                  </Seq-loc>
1320                </Seq-feat_location>
1321                <Seq-feat_qual>
1322                  <Gb-qual>
1323                    <Gb-qual_qual>experiment</Gb-qual_qual>
1324                    <Gb-qual_val>experimental evidence, no additional details recorded</Gb-qual_val>
1325                  </Gb-qual>
1326                  <Gb-qual>
1327                    <Gb-qual_qual>standard_name</Gb-qual_qual>
1328                    <Gb-qual_val>BBFa</Gb-qual_val>
1329                  </Gb-qual>
1330                </Seq-feat_qual>
1331                <Seq-feat_exp-ev value="experimental"/>
1332                <Seq-feat_dbxref>
1333                  <Dbtag>
1334                    <Dbtag_db>GOA</Dbtag_db>
1335                    <Dbtag_tag>
1336                      <Object-id>
1337                        <Object-id_str>Q43385</Object-id_str>
1338                      </Object-id>
1339                    </Dbtag_tag>
1340                  </Dbtag>
1341                  <Dbtag>
1342                    <Dbtag_db>InterPro</Dbtag_db>
1343                    <Dbtag_tag>
1344                      <Object-id>
1345                        <Object-id_str>IPR003851</Object-id_str>
1346                      </Object-id>
1347                    </Dbtag_tag>
1348                  </Dbtag>
1349                  <Dbtag>
1350                    <Dbtag_db>UniProtKB/Swiss-Prot</Dbtag_db>
1351                    <Dbtag_tag>
1352                      <Object-id>
1353                        <Object-id_str>Q43385</Object-id_str>
1354                      </Object-id>
1355                    </Dbtag_tag>
1356                  </Dbtag>
1357                </Seq-feat_dbxref>
1358              </Seq-feat>
1359            </Seq-annot_data_ftable>
1360          </Seq-annot_data>
1361        </Seq-annot>
1362      </Bioseq-set_annot>
1363    </Bioseq-set>
1364  </Seq-entry_set>
1365</Seq-entry>
1366</Bioseq-set_seq-set>
1367</Bioseq-set>