OpenBio*: aj224122.asn1

File aj224122.asn1, 17.9 KB (added by jan.aerts, 16 years ago)

AJ224122 in ASN1 format as downloaded from NCBI

Line 
1Seq-entry ::= set {
2  level 1 ,
3  class nuc-prot ,
4  descr {
5    pub {
6      pub {
7        sub {
8          authors {
9            names
10              std {
11                {
12                  name
13                    name {
14                      last "Vittorioso" ,
15                      initials "P." } } } ,
16            affil
17              str "Vittorioso P., Dip. Genetica e Biologia Molecolare,
18 Universita di Roma La Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY" } ,
19          medium other ,
20          date
21            std {
22              year 1998 ,
23              month 2 ,
24              day 24 } } } ,
25      comment "revised by [3]" ,
26      reftype no-target } ,
27    pub {
28      pub {
29        pmid 8771779 ,
30        article {
31          title {
32            name "A rolB regulatory factor belongs to a new class of single
33 zinc finger plant proteins." } ,
34          authors {
35            names
36              std {
37                {
38                  name
39                    name {
40                      last "De Paolis" ,
41                      initials "A." } } ,
42                {
43                  name
44                    name {
45                      last "Sabatini" ,
46                      initials "S." } } ,
47                {
48                  name
49                    name {
50                      last "De Pascalis" ,
51                      initials "L." } } ,
52                {
53                  name
54                    name {
55                      last "Costantino" ,
56                      initials "P." } } ,
57                {
58                  name
59                    name {
60                      last "Capone" ,
61                      initials "I." } } } ,
62            affil
63              str "Istituto Pasteur Fondazione Cenci Bolognetti, Dip. Genetica
64 e Biologia Molecolare, Universita di Roma La Sapienza, Italy." } ,
65          from
66            journal {
67              title {
68                iso-jta "Plant J." ,
69                ml-jta "Plant J" ,
70                issn "0960-7412" ,
71                name "The Plant journal : for cell and molecular biology" } ,
72              imp {
73                date
74                  std {
75                    year 1996 ,
76                    month 8 } ,
77                volume "10" ,
78                issue "2" ,
79                pages "215-223" ,
80                language "eng" ,
81                pubstatus ppublish ,
82                history {
83                  {
84                    pubstatus pubmed ,
85                    date
86                      std {
87                        year 1996 ,
88                        month 8 ,
89                        day 1 } } ,
90                  {
91                    pubstatus medline ,
92                    date
93                      std {
94                        year 1996 ,
95                        month 8 ,
96                        day 1 ,
97                        hour 0 ,
98                        minute 1 } } } } } ,
99          ids {
100            pubmed 8771779 } } } ,
101      reftype no-target } ,
102    pub {
103      pub {
104        sub {
105          authors {
106            names
107              std {
108                {
109                  name
110                    name {
111                      last "Vittorioso" ,
112                      initials "P." } } } ,
113            affil
114              str "Vittorioso P., Dip. Genetica e Biologia Molecolare,
115 Universita di Roma La Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY" } ,
116          medium other ,
117          date
118            std {
119              year 1999 ,
120              month 2 ,
121              day 25 } } } ,
122      comment "revised by [4]" ,
123      reftype no-target } ,
124    pub {
125      pub {
126        sub {
127          authors {
128            names
129              std {
130                {
131                  name
132                    name {
133                      last "Vittorioso" ,
134                      initials "P." } } } ,
135            affil
136              str "Vittorioso P., Dip. Genetica e Biologia Molecolare,
137 Universita di Roma La Sapienza, P.le Aldo Moro, 5; , 00185 Rome, ITALY" } ,
138          medium other ,
139          date
140            std {
141              year 2001 ,
142              month 4 ,
143              day 12 } } } } ,
144    pub {
145      pub {
146        pmid 10640273 ,
147        article {
148          title {
149            name "Identification and disruption of an Arabidopsis zinc finger
150 gene controlling seed germination." } ,
151          authors {
152            names
153              std {
154                {
155                  name
156                    name {
157                      last "Papi" ,
158                      initials "M." } } ,
159                {
160                  name
161                    name {
162                      last "Sabatini" ,
163                      initials "S." } } ,
164                {
165                  name
166                    name {
167                      last "Bouchez" ,
168                      initials "D." } } ,
169                {
170                  name
171                    name {
172                      last "Camilleri" ,
173                      initials "C." } } ,
174                {
175                  name
176                    name {
177                      last "Costantino" ,
178                      initials "P." } } ,
179                {
180                  name
181                    name {
182                      last "Vittorioso" ,
183                      initials "P." } } } ,
184            affil
185              str "Istituto Pasteur Fondazione Cenci Bolognetti, Dipartimento
186 di Genetica e Biologia Molecolare, Universit inverted question marka ""La
187 Sapienza,"" 00185 Rome, Italy." } ,
188          from
189            journal {
190              title {
191                iso-jta "Genes Dev." ,
192                ml-jta "Genes Dev" ,
193                issn "0890-9369" ,
194                name "Genes & development" } ,
195              imp {
196                date
197                  std {
198                    year 2000 ,
199                    month 1 ,
200                    day 1 } ,
201                volume "14" ,
202                issue "1" ,
203                pages "28-33" ,
204                language "eng" ,
205                pubstatus ppublish ,
206                history {
207                  {
208                    pubstatus pubmed ,
209                    date
210                      std {
211                        year 2000 ,
212                        month 1 ,
213                        day 20 ,
214                        hour 9 ,
215                        minute 0 } } ,
216                  {
217                    pubstatus medline ,
218                    date
219                      std {
220                        year 2000 ,
221                        month 2 ,
222                        day 19 ,
223                        hour 9 ,
224                        minute 0 } } } } } ,
225          ids {
226            pubmed 10640273 } } } ,
227      reftype no-target } ,
228    update-date
229      std {
230        year 2006 ,
231        month 11 ,
232        day 14 } ,
233    source {
234      org {
235        taxname "Arabidopsis thaliana" ,
236        common "thale cress" ,
237        db {
238          {
239            db "taxon" ,
240            tag
241              id 3702 } } ,
242        orgname {
243          name
244            binomial {
245              genus "Arabidopsis" ,
246              species "thaliana" } ,
247          mod {
248            {
249              subtype cultivar ,
250              subname "Wassilewskija" } ,
251            {
252              subtype ecotype ,
253              subname "Wassilewskija" } ,
254            {
255              subtype old-name ,
256              subname "Arabidopsis thaliana" ,
257              attrib "(10)cultivar=Wassilewskija" } } ,
258          lineage "Eukaryota; Viridiplantae; Streptophyta; Embryophyta;
259 Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core
260 eudicotyledons; rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis" ,
261          gcode 1 ,
262          mgcode 1 ,
263          div "PLN" } } ,
264      subtype {
265        {
266          subtype chromosome ,
267          name "3" } } } ,
268    create-date
269      std {
270        year 1998 ,
271        month 2 ,
272        day 27 } } ,
273  seq-set {
274    seq {
275      id {
276        embl {
277          accession "AJ224122" ,
278          version 3 } ,
279        gi 13938851 } ,
280      descr {
281        title "Arabidopsis thaliana DAG1 gene" ,
282        embl {
283          div pln ,
284          creation-date
285            std {
286              year 1998 ,
287              month 2 ,
288              day 27 } ,
289          update-date
290            std {
291              year 2006 ,
292              month 11 ,
293              day 14 } ,
294          keywords {
295            "BBFa gene" ,
296            "transcription factor" } } ,
297        molinfo {
298          biomol genomic } } ,
299      inst {
300        repr raw ,
301        mol dna ,
302        length 3827 ,
303        seq-data
304          ncbi2na '0F0065190A63DCA0340184603BAAEAEFEACA0212FB4134A8FE8F8340000
305B5F23F4C0270D197401EA97377DFFFB67D7B6B5F773F7DD41574FFE0CFC4C1016FF1FDFEB403C8
3065403DCCF2FC233BADEC3F3EFB3E33003CBCC263CCFFCE742C1EBBCBC1CCF5146305E3C4C0338FF
3070D3FCB014CD91BE8E3C3FC1AFC3046E3C0F3FF20E3CFC406802733B8443076E4B3EF2FE00BB3FA
308FDF33FA5D8FF4BF3B9FFC40BFCFF6F37BF06613FBECE9FC58FE20C034CF17F3B253BBAEC3330C3
309AD7DC6000923443E0302AE03FAED5FF7DB6030481C0C0202EF32CCF1B5820C3533D780C4B4133C
310CCFCB1FCCC0BCA0F034CEFF3614CF0B441FCD303C37B0F20F50BD94583F6C170DC4CC32300CCCC
311EC8B0F38CDCECECB4EB3383FE03E90AC13E1A36C15040C33C3C403ABA9A832CC41D30F51D1FFEC
312F3CA3380C22C3413930C08ECC3F7D37C00130713AFC3110FF17FCD000B3F443D1D903C6038E9CB
3139F41D40FD833FC0D18EEC817FCFC7A31C3472FCF894143CBC0C810D0CF325233FFD7F0033F008A
314A520081488A8A53884F3CD1CB40041015D7FE7FF4CC0F3CCFF3FE4AFDF77DF7DF7DF7DF7D77E9E
3157F7F4D35302E027064C88894CDB54000900B500001075004F777C9DFC77F2FDDDDDDDE5FDDFEF8
3162F4E8E7182E874AC6C008CDDDE7337BFBFB27DD561DD19DDDDDDDDDDDFEECDDDC744C0CCC4EEEE
317CE4EFCCECECE014B2EBCC48CB73322334338EEFF0FC87FF3335BF807D60BDD83A2F0A0BFEF7710
318BD0FFDFB4F0F300778C1C3A3000ACE7FBCBC5FFBDFAE74ADF14FFFD703FC3CB75FDFC3C3FCEF06
31947863F06F040005C8F7FF7FD0C8930F3C7D0FD3F37447015C37E980F5FF333303F0F0FFD4437E9
320A0F4A1DAFF9FBCFBDDDFF0FE13AF2A0C7C0B3B7C3FCCABFD080E301B0250E89038FDC914104111
321641041413D36514110A5019459350EBA75A280C50411A718E80720298A510880B03ED423907410
3221102F7BCF1041C4B746414231F7902BED82B3E8582BA777DB06D52DA2B274202042235DC45FC9F
32345F70D501F5237015163DFF742503570C2D03023741F9CDFD5AD3908D34D34EB3B74FFFD339508
324C8810431F4D743739F4D375EDD277E27DC2350E8B77D08A4E046F7E5EB40E3A3D01D2D7B1D37F2
325AFD410E5E3C4048B0C105FD3DD4F8D34D0A8FA130453412C14089D08C10E384E0E890B2AFFBD5F
326FD2138089FD0910542208B4EB0C3133E83A8EF4B0C4A28DF4EB8002BC0089D381CD27F7DDFFDEF
327FFDD73FCF32FFC7F8E37FEFFF744EA81FC7C0BED207CBF123EDFFCF5F7F7AFF5FFF5FFFCD2DFFC
328033B3F4C3EAFE34F4CFCF2CD00C8B73BD38A8BBC2ABB8AB20830B831AA958'H ,
329        hist {
330          replaces {
331            date
332              std {
333                year 2001 ,
334                month 5 ,
335                day 3 } ,
336            ids {
337              gi 4469119 } } } } ,
338      annot {
339        {
340          data
341            ftable {
342              {
343                data
344                  rna {
345                    type mRNA ,
346                    ext
347                      name "DNA-binding protein" } ,
348                location
349                  mix {
350                    int {
351                      from 1725 ,
352                      to 1862 ,
353                      id
354                        gi 13938851 } ,
355                    int {
356                      from 2547 ,
357                      to 3051 ,
358                      id
359                        gi 13938851 } ,
360                    int {
361                      from 3136 ,
362                      to 3826 ,
363                      id
364                        gi 13938851 } } ,
365                qual {
366                  {
367                    qual "experiment" ,
368                    val "experimental evidence, no additional details recorded" } ,
369                  {
370                    qual "function" ,
371                    val "transcription factor" } } ,
372                exp-ev experimental } ,
373              {
374                data
375                  imp {
376                    key "exon" } ,
377                location
378                  int {
379                    from 1725 ,
380                    to 1862 ,
381                    id
382                      gi 13938851 } ,
383                qual {
384                  {
385                    qual "number" ,
386                    val "1" } } } ,
387              {
388                data
389                  imp {
390                    key "intron" } ,
391                location
392                  int {
393                    from 1863 ,
394                    to 2546 ,
395                    id
396                      gi 13938851 } ,
397                qual {
398                  {
399                    qual "number" ,
400                    val "1" } } } ,
401              {
402                data
403                  imp {
404                    key "exon" } ,
405                location
406                  int {
407                    from 2547 ,
408                    to 3051 ,
409                    id
410                      gi 13938851 } ,
411                qual {
412                  {
413                    qual "number" ,
414                    val "2" } } } ,
415              {
416                data
417                  imp {
418                    key "intron" } ,
419                location
420                  int {
421                    from 3052 ,
422                    to 3135 ,
423                    id
424                      gi 13938851 } ,
425                qual {
426                  {
427                    qual "number" ,
428                    val "2" } } } ,
429              {
430                data
431                  imp {
432                    key "exon" } ,
433                location
434                  int {
435                    from 3136 ,
436                    to 3494 ,
437                    id
438                      gi 13938851 } ,
439                qual {
440                  {
441                    qual "number" ,
442                    val "3" } } } ,
443              {
444                data
445                  gene {
446                    locus "DAG1" } ,
447                location
448                  int {
449                    from 1725 ,
450                    to 3826 ,
451                    id
452                      gi 13938851 } } } } } } ,
453    seq {
454      id {
455        embl {
456          accession "CAB40190" ,
457          version 1 } ,
458        gi 4581965 } ,
459      descr {
460        title "DNA-binding protein [Arabidopsis thaliana]" ,
461        molinfo {
462          biomol peptide } } ,
463      inst {
464        repr raw ,
465        mol aa ,
466        length 296 ,
467        seq-data
468          ncbieaa "MDATKWTQGFQEMINVKPMEQMISSTNNNTPQQQPTFIATNTRPNATASNGGSGGNTNN
469TATMETRKARPQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTPLASPS
470NPKLPDLNPPILFSSQIPNKSNKDLNLLSFPVMQDHHHHALELLRSNGVSSRGMNTFLPGQMMDSNSVLYSSLGFPTM
471PDYKQSNNNLSFSIDHHQGIGHNTINSNQRAQDNNDDMNGASRVLFPFSDMKELSSTTQEKSHGNNTYWNGMFSNTGG
472SSW" } ,
473      annot {
474        {
475          data
476            ftable {
477              {
478                data
479                  prot {
480                    name {
481                      "DNA-binding protein" } ,
482                    activity {
483                      "transcription factor" } } ,
484                location
485                  int {
486                    from 0 ,
487                    to 295 ,
488                    id
489                      gi 4581965 } } } } ,
490        {
491          db other ,
492          name "Annot:CDD" ,
493          desc {
494            name "CDDSearch" ,
495            create-date
496              std {
497                year 2007 ,
498                month 10 ,
499                day 26 ,
500                hour 3 ,
501                minute 4 ,
502                second 27 } } ,
503          data
504            ftable {
505              {
506                data
507                  region "zf-Dof" ,
508                comment "Dof domain, zinc finger. The Dof domain is a zinc
509 finger DNA-binding domain, that shows resemblance to the Cys2 zinc finger." ,
510                location
511                  int {
512                    from 68 ,
513                    to 130 ,
514                    id
515                      gi 4581965 } ,
516                ext {
517                  type
518                    str "cddScoreData" ,
519                  data {
520                    {
521                      label
522                        str "definition" ,
523                      data
524                        str "pfam02701" } ,
525                    {
526                      label
527                        str "short_name" ,
528                      data
529                        str "zf-Dof" } ,
530                    {
531                      label
532                        str "score" ,
533                      data
534                        int 297 } ,
535                    {
536                      label
537                        str "evalue" ,
538                      data
539                        real { 148043, 10, -32 } } ,
540                    {
541                      label
542                        str "bit_score" ,
543                      data
544                        real { 118522, 10, -3 } } } } ,
545                dbxref {
546                  {
547                    db "CDD" ,
548                    tag
549                      id 66392 } } } } } } } } ,
550  annot {
551    {
552      data
553        ftable {
554          {
555            data
556              cdregion {
557                frame one ,
558                code {
559                  id 1 } } ,
560            product
561              whole
562                gi 4581965 ,
563            location
564              mix {
565                int {
566                  from 1839 ,
567                  to 1862 ,
568                  id
569                    gi 13938851 } ,
570                int {
571                  from 2547 ,
572                  to 3051 ,
573                  id
574                    gi 13938851 } ,
575                int {
576                  from 3136 ,
577                  to 3497 ,
578                  id
579                    gi 13938851 } } ,
580            qual {
581              {
582                qual "experiment" ,
583                val "experimental evidence, no additional details recorded" } ,
584              {
585                qual "standard_name" ,
586                val "BBFa" } } ,
587            exp-ev experimental ,
588            dbxref {
589              {
590                db "GOA" ,
591                tag
592                  str "Q43385" } ,
593              {
594                db "InterPro" ,
595                tag
596                  str "IPR003851" } ,
597              {
598                db "UniProtKB/Swiss-Prot" ,
599                tag
600                  str "Q43385" } } } } } } }
601