OpenBio*: dag1.asn1

File dag1.asn1, 58.0 KB (added by jan.aerts, 16 years ago)

DAG1 gene: ASN.1 formatted file exported from NCBI

Line 
1Seq-entry ::= set {
2  level 1 ,
3  class nuc-prot ,
4  descr {
5    source {
6      genome genomic ,
7      org {
8        taxname "Homo sapiens" ,
9        common "human" ,
10        db {
11          {
12            db "taxon" ,
13            tag
14              id 9606 } } ,
15        orgname {
16          name
17            binomial {
18              genus "Homo" ,
19              species "sapiens" } ,
20          lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
21 Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
22 Catarrhini; Hominidae; Homo" ,
23          gcode 1 ,
24          mgcode 2 ,
25          div "PRI" } } ,
26      subtype {
27        {
28          subtype chromosome ,
29          name "3" } ,
30        {
31          subtype map ,
32          name "3p21" } } } ,
33    comment "~Summary: Dystroglycan is a laminin binding component of the
34 dystrophin-glycoprotein complex which provides a linkage between the
35 subsarcolemmal cytoskeleton and the extracellular matrix. Dystroglycan 1 is a
36 candidate gene for the site of the mutation in autosomal recessive muscular
37 dystrophies. The dramatic reduction of dystroglycan 1 in Duchenne muscular
38 dystrophy leads to a loss of linkage between the sarcolemma and extracellular
39 matrix, rendering muscle fibers more susceptible to necrosis. Dystroglycan
40 also functions as dual receptor for agrin and laminin-2 in the Schwann cell
41 membrane. The muscle and nonmuscle isoforms of dystroglycan differ by
42 carbohydrate moieties but not protein sequence." ,
43    user {
44      type
45        str "RefGeneTracking" ,
46      data {
47        {
48          label
49            str "Status" ,
50          data
51            str "Reviewed" } ,
52        {
53          label
54            str "Assembly" ,
55          data
56            fields {
57              {
58                label
59                  id 0 ,
60                data
61                  fields {
62                    {
63                      label
64                        str "accession" ,
65                      data
66                        str "DA851197.1" } } } ,
67              {
68                label
69                  id 0 ,
70                data
71                  fields {
72                    {
73                      label
74                        str "accession" ,
75                      data
76                        str "BC012740.2" } ,
77                    {
78                      label
79                        str "gi" ,
80                      data
81                        int 15215308 } } } ,
82              {
83                label
84                  id 0 ,
85                data
86                  fields {
87                    {
88                      label
89                        str "accession" ,
90                      data
91                        str "L19711.1" } ,
92                    {
93                      label
94                        str "gi" ,
95                      data
96                        int 398026 } } } ,
97              {
98                label
99                  id 0 ,
100                data
101                  fields {
102                    {
103                      label
104                        str "accession" ,
105                      data
106                        str "CX871468.1" } } } ,
107              {
108                label
109                  id 0 ,
110                data
111                  fields {
112                    {
113                      label
114                        str "accession" ,
115                      data
116                        str "BX402174.2" } } } ,
117              {
118                label
119                  id 0 ,
120                data
121                  fields {
122                    {
123                      label
124                        str "accession" ,
125                      data
126                        str "BF476692.1" } } } ,
127              {
128                label
129                  id 0 ,
130                data
131                  fields {
132                    {
133                      label
134                        str "accession" ,
135                      data
136                        str "AW204012.1" } } } } } } } ,
137    comment "~Publication Note:  This RefSeq record includes a subset of the
138 publications that are available for this gene. Please see the Entrez Gene
139 record to access additional publications." ,
140    pub {
141      pub {
142        pmid 17640712 ,
143        article {
144          title {
145            name "Altered expression of natively glycosylated alpha
146 dystroglycan in pediatric solid tumors." } ,
147          authors {
148            names
149              std {
150                {
151                  name
152                    name {
153                      last "Martin" ,
154                      initials "L.T." } } ,
155                {
156                  name
157                    name {
158                      last "Glass" ,
159                      initials "M." } } ,
160                {
161                  name
162                    name {
163                      last "Dosunmu" ,
164                      initials "E." } } ,
165                {
166                  name
167                    name {
168                      last "Martin" ,
169                      initials "P.T." } } } ,
170            affil
171              str "Division of Pediatric Hematology/Oncology, Department of
172 Pediatrics, Ohio State University College of Medicine and Public Health,
173 Columbus, OH 43205, USA. martinlt@pediatrics.ohio-state.edu" } ,
174          from
175            journal {
176              title {
177                iso-jta "Hum. Pathol." ,
178                ml-jta "Hum Pathol" ,
179                issn "0046-8177" ,
180                name "Human pathology" } ,
181              imp {
182                date
183                  std {
184                    year 2007 ,
185                    month 11 } ,
186                volume "38" ,
187                issue "11" ,
188                pages "1657-1668" ,
189                language "eng" ,
190                pubstatus ppublish ,
191                history {
192                  {
193                    pubstatus received ,
194                    date
195                      std {
196                        year 2006 ,
197                        month 7 ,
198                        day 10 } } ,
199                  {
200                    pubstatus revised ,
201                    date
202                      std {
203                        year 2006 ,
204                        month 11 ,
205                        day 28 } } ,
206                  {
207                    pubstatus accepted ,
208                    date
209                      std {
210                        year 2007 ,
211                        month 3 ,
212                        day 12 } } ,
213                  {
214                    pubstatus aheadofprint ,
215                    date
216                      std {
217                        year 2007 ,
218                        month 7 ,
219                        day 19 } } ,
220                  {
221                    pubstatus pubmed ,
222                    date
223                      std {
224                        year 2007 ,
225                        month 7 ,
226                        day 21 ,
227                        hour 9 ,
228                        minute 0 } } ,
229                  {
230                    pubstatus medline ,
231                    date
232                      std {
233                        year 2007 ,
234                        month 12 ,
235                        day 21 ,
236                        hour 9 ,
237                        minute 0 } } } } } ,
238          ids {
239            pii "S0046-8177(07)00162-1" ,
240            doi "10.1016/j.humpath.2007.03.025" ,
241            pubmed 17640712 } } } ,
242      comment "GeneRIF: alpha dystroglycan glycosylation & laminin binding to
243 alpha dystroglycan are altered in certain pediatric solid tumors and suggest
244 that aberrant dystroglycan glycosylation may contribute to tumor cell biology
245 in patients with RMS, medulloblastoma, & NBL." } ,
246    pub {
247      pub {
248        pmid 17516554 ,
249        article {
250          title {
251            name "Dystroglycan expression is reduced during prostate
252 tumorigenesis and is regulated by androgens in prostate cancer cells." } ,
253          authors {
254            names
255              std {
256                {
257                  name
258                    name {
259                      last "Sgambato" ,
260                      initials "A." } } ,
261                {
262                  name
263                    name {
264                      last "De Paola" ,
265                      initials "B." } } ,
266                {
267                  name
268                    name {
269                      last "Migaldi" ,
270                      initials "M." } } ,
271                {
272                  name
273                    name {
274                      last "Di Salvatore" ,
275                      initials "M." } } ,
276                {
277                  name
278                    name {
279                      last "Rettino" ,
280                      initials "A." } } ,
281                {
282                  name
283                    name {
284                      last "Rossi" ,
285                      initials "G." } } ,
286                {
287                  name
288                    name {
289                      last "Faraglia" ,
290                      initials "B." } } ,
291                {
292                  name
293                    name {
294                      last "Boninsegna" ,
295                      initials "A." } } ,
296                {
297                  name
298                    name {
299                      last "Maiorana" ,
300                      initials "A." } } ,
301                {
302                  name
303                    name {
304                      last "Cittadini" ,
305                      initials "A." } } } ,
306            affil
307              str "Laboratorio di Oncologia Molecolare, Centro di Riferimento
308 Oncologico di Basilicata, Rionero in Vulture (PZ), Italy.
309 asgambato@rm.unicatt.it" } ,
310          from
311            journal {
312              title {
313                iso-jta "J. Cell. Physiol." ,
314                ml-jta "J Cell Physiol" ,
315                issn "0021-9541" ,
316                name "Journal of cellular physiology" } ,
317              imp {
318                date
319                  std {
320                    year 2007 ,
321                    month 11 } ,
322                volume "213" ,
323                issue "2" ,
324                pages "528-539" ,
325                language "eng" ,
326                pubstatus ppublish ,
327                history {
328                  {
329                    pubstatus pubmed ,
330                    date
331                      std {
332                        year 2007 ,
333                        month 5 ,
334                        day 23 ,
335                        hour 9 ,
336                        minute 0 } } ,
337                  {
338                    pubstatus medline ,
339                    date
340                      std {
341                        year 2008 ,
342                        month 1 ,
343                        day 23 ,
344                        hour 9 ,
345                        minute 0 } } } } } ,
346          ids {
347            doi "10.1002/jcp.21130" ,
348            pubmed 17516554 } } } ,
349      comment "GeneRIF: Data suggest that disturbances in the function of the
350 dystroglycan complex might contribute to the definition of the malignant
351 behavior of prostate cancer cells and suggest that androgens might regulate
352 DG expression in these cells." } ,
353    pub {
354      pub {
355        pmid 17012237 ,
356        article {
357          title {
358            name "Activation of muscle-specific receptor tyrosine kinase and
359 binding to dystroglycan are regulated by alternative mRNA splicing of agrin." } ,
360          authors {
361            names
362              std {
363                {
364                  name
365                    name {
366                      last "Scotton" ,
367                      initials "P." } } ,
368                {
369                  name
370                    name {
371                      last "Bleckmann" ,
372                      initials "D." } } ,
373                {
374                  name
375                    name {
376                      last "Stebler" ,
377                      initials "M." } } ,
378                {
379                  name
380                    name {
381                      last "Sciandra" ,
382                      initials "F." } } ,
383                {
384                  name
385                    name {
386                      last "Brancaccio" ,
387                      initials "A." } } ,
388                {
389                  name
390                    name {
391                      last "Meier" ,
392                      initials "T." } } ,
393                {
394                  name
395                    name {
396                      last "Stetefeld" ,
397                      initials "J." } } ,
398                {
399                  name
400                    name {
401                      last "Ruegg" ,
402                      initials "M.A." } } } ,
403            affil
404              str "Biozentrum, University of Basel, Klingelbergstrasse 70,
405 CH-4056 Basel, Switzerland." } ,
406          from
407            journal {
408              title {
409                iso-jta "J. Biol. Chem." ,
410                ml-jta "J Biol Chem" ,
411                issn "0021-9258" ,
412                name "The Journal of biological chemistry" } ,
413              imp {
414                date
415                  std {
416                    year 2006 ,
417                    month 12 ,
418                    day 1 } ,
419                volume "281" ,
420                issue "48" ,
421                pages "36835-36845" ,
422                language "eng" ,
423                pubstatus ppublish ,
424                history {
425                  {
426                    pubstatus aheadofprint ,
427                    date
428                      std {
429                        year 2006 ,
430                        month 9 ,
431                        day 29 } } ,
432                  {
433                    pubstatus pubmed ,
434                    date
435                      std {
436                        year 2006 ,
437                        month 10 ,
438                        day 3 ,
439                        hour 9 ,
440                        minute 0 } } ,
441                  {
442                    pubstatus medline ,
443                    date
444                      std {
445                        year 2007 ,
446                        month 1 ,
447                        day 31 ,
448                        hour 9 ,
449                        minute 0 } } } } } ,
450          ids {
451            pii "M607887200" ,
452            doi "10.1074/jbc.M607887200" ,
453            pubmed 17012237 } } } ,
454      comment "GeneRIF: muscle-specific receptor tyrosine kinase activation
455 and binding to dystroglycan are regulated by alternative mRNA splicing of
456 agrin" } ,
457    pub {
458      pub {
459        pmid 17005282 ,
460        article {
461          title {
462            name "Intracellular binding of fukutin and alpha-dystroglycan:
463 relation to glycosylation of alpha-dystroglycan." } ,
464          authors {
465            names
466              std {
467                {
468                  name
469                    name {
470                      last "Yamamoto" ,
471                      initials "T." } } ,
472                {
473                  name
474                    name {
475                      last "Kawaguchi" ,
476                      initials "M." } } ,
477                {
478                  name
479                    name {
480                      last "Sakayori" ,
481                      initials "N." } } ,
482                {
483                  name
484                    name {
485                      last "Muramatsu" ,
486                      initials "F." } } ,
487                {
488                  name
489                    name {
490                      last "Morikawa" ,
491                      initials "S." } } ,
492                {
493                  name
494                    name {
495                      last "Kato" ,
496                      initials "Y." } } ,
497                {
498                  name
499                    name {
500                      last "Shibata" ,
501                      initials "N." } } ,
502                {
503                  name
504                    name {
505                      last "Kobayashi" ,
506                      initials "M." } } } ,
507            affil
508              str "Department of Pathology, Tokyo Women's Medical University,
509 Tokyo, Japan. sheto@research.twmu.ac.jp" } ,
510          from
511            journal {
512              title {
513                iso-jta "Neurosci. Res." ,
514                ml-jta "Neurosci Res" ,
515                issn "0168-0102" ,
516                name "Neuroscience research" } ,
517              imp {
518                date
519                  std {
520                    year 2006 ,
521                    month 12 } ,
522                volume "56" ,
523                issue "4" ,
524                pages "391-399" ,
525                language "eng" ,
526                pubstatus ppublish ,
527                history {
528                  {
529                    pubstatus received ,
530                    date
531                      std {
532                        year 2006 ,
533                        month 1 ,
534                        day 21 } } ,
535                  {
536                    pubstatus revised ,
537                    date
538                      std {
539                        year 2006 ,
540                        month 8 ,
541                        day 14 } } ,
542                  {
543                    pubstatus accepted ,
544                    date
545                      std {
546                        year 2006 ,
547                        month 8 ,
548                        day 17 } } ,
549                  {
550                    pubstatus aheadofprint ,
551                    date
552                      std {
553                        year 2006 ,
554                        month 9 ,
555                        day 26 } } ,
556                  {
557                    pubstatus pubmed ,
558                    date
559                      std {
560                        year 2006 ,
561                        month 9 ,
562                        day 29 ,
563                        hour 9 ,
564                        minute 0 } } ,
565                  {
566                    pubstatus medline ,
567                    date
568                      std {
569                        year 2007 ,
570                        month 1 ,
571                        day 18 ,
572                        hour 9 ,
573                        minute 0 } } } } } ,
574          ids {
575            pii "S0168-0102(06)00215-X" ,
576            doi "10.1016/j.neures.2006.08.009" ,
577            pubmed 17005282 } } } ,
578      comment "GeneRIF: Fukutin seems to bind to both the hypoglycosylated and
579 fully glycosylated form of alpha-dystroglycan, and seems bind to the core
580 area rather than the sugar chain of alpha-dystroglycan" } ,
581    pub {
582      pub {
583        pmid 16709410 ,
584        article {
585          title {
586            name "Brain alpha-dystroglycan displays unique glycoepitopes and
587 preferential binding to laminin-10/11." } ,
588          authors {
589            names
590              std {
591                {
592                  name
593                    name {
594                      last "McDearmon" ,
595                      initials "E.L." } } ,
596                {
597                  name
598                    name {
599                      last "Combs" ,
600                      initials "A.C." } } ,
601                {
602                  name
603                    name {
604                      last "Sekiguchi" ,
605                      initials "K." } } ,
606                {
607                  name
608                    name {
609                      last "Fujiwara" ,
610                      initials "H." } } ,
611                {
612                  name
613                    name {
614                      last "Ervasti" ,
615                      initials "J.M." } } } ,
616            affil
617              str "Department of Physiology, University of Wisconsin, Madison,
618 53706, USA." } ,
619          from
620            journal {
621              title {
622                iso-jta "FEBS Lett." ,
623                ml-jta "FEBS Lett" ,
624                issn "0014-5793" ,
625                name "FEBS letters" } ,
626              imp {
627                date
628                  std {
629                    year 2006 ,
630                    month 6 ,
631                    day 12 } ,
632                volume "580" ,
633                issue "14" ,
634                pages "3381-3385" ,
635                language "eng" ,
636                pubstatus ppublish ,
637                history {
638                  {
639                    pubstatus received ,
640                    date
641                      std {
642                        year 2006 ,
643                        month 2 ,
644                        day 14 } } ,
645                  {
646                    pubstatus revised ,
647                    date
648                      std {
649                        year 2006 ,
650                        month 4 ,
651                        day 18 } } ,
652                  {
653                    pubstatus accepted ,
654                    date
655                      std {
656                        year 2006 ,
657                        month 5 ,
658                        day 2 } } ,
659                  {
660                    pubstatus aheadofprint ,
661                    date
662                      std {
663                        year 2006 ,
664                        month 5 ,
665                        day 11 } } ,
666                  {
667                    pubstatus pubmed ,
668                    date
669                      std {
670                        year 2006 ,
671                        month 5 ,
672                        day 20 ,
673                        hour 9 ,
674                        minute 0 } } ,
675                  {
676                    pubstatus medline ,
677                    date
678                      std {
679                        year 2006 ,
680                        month 7 ,
681                        day 28 ,
682                        hour 9 ,
683                        minute 0 } } } } } ,
684          ids {
685            pii "S0014-5793(06)00595-3" ,
686            doi "10.1016/j.febslet.2006.05.010" ,
687            pubmed 16709410 } } } } ,
688    pub {
689      pub {
690        pmid 7774920 ,
691        article {
692          title {
693            name "Genetic mapping of the mouse neuromuscular mutation
694 kyphoscoliosis." } ,
695          authors {
696            names
697              std {
698                {
699                  name
700                    name {
701                      last "Skynner" ,
702                      initials "M.J." } } ,
703                {
704                  name
705                    name {
706                      last "Gangadharan" ,
707                      initials "U." } } ,
708                {
709                  name
710                    name {
711                      last "Coulton" ,
712                      initials "G.R." } } ,
713                {
714                  name
715                    name {
716                      last "Mason" ,
717                      initials "R.M." } } ,
718                {
719                  name
720                    name {
721                      last "Nikitopoulou" ,
722                      initials "A." } } ,
723                {
724                  name
725                    name {
726                      last "Brown" ,
727                      initials "S.D." } } ,
728                {
729                  name
730                    name {
731                      last "Blanco" ,
732                      initials "G." } } } ,
733            affil
734              str "Department of Biochemistry, Charing Cross and Westminster
735 Hospital Medical School, London, United Kingdom." } ,
736          from
737            journal {
738              title {
739                iso-jta "Genomics" ,
740                ml-jta "Genomics" ,
741                issn "0888-7543" ,
742                name "Genomics" } ,
743              imp {
744                date
745                  std {
746                    year 1995 ,
747                    month 1 ,
748                    day 1 } ,
749                volume "25" ,
750                issue "1" ,
751                pages "207-213" ,
752                language "eng" ,
753                pubstatus ppublish ,
754                history {
755                  {
756                    pubstatus pubmed ,
757                    date
758                      std {
759                        year 1995 ,
760                        month 1 ,
761                        day 1 } } ,
762                  {
763                    pubstatus medline ,
764                    date
765                      std {
766                        year 1995 ,
767                        month 1 ,
768                        day 1 ,
769                        hour 0 ,
770                        minute 1 } } } } } ,
771          ids {
772            pubmed 7774920 ,
773            pii "0888-7543(95)80127-8" } } } } ,
774    pub {
775      pub {
776        pmid 7744812 ,
777        article {
778          title {
779            name "SH3 domain-mediated interaction of dystroglycan and Grb2." } ,
780          authors {
781            names
782              std {
783                {
784                  name
785                    name {
786                      last "Yang" ,
787                      initials "B." } } ,
788                {
789                  name
790                    name {
791                      last "Jung" ,
792                      initials "D." } } ,
793                {
794                  name
795                    name {
796                      last "Motto" ,
797                      initials "D." } } ,
798                {
799                  name
800                    name {
801                      last "Meyer" ,
802                      initials "J." } } ,
803                {
804                  name
805                    name {
806                      last "Koretzky" ,
807                      initials "G." } } ,
808                {
809                  name
810                    name {
811                      last "Campbell" ,
812                      initials "K.P." } } } ,
813            affil
814              str "Howard Hughes Medical Institute, College of Medicine, Iowa
815 City, Iowa, USA." } ,
816          from
817            journal {
818              title {
819                iso-jta "J. Biol. Chem." ,
820                ml-jta "J Biol Chem" ,
821                issn "0021-9258" ,
822                name "The Journal of biological chemistry" } ,
823              imp {
824                date
825                  std {
826                    year 1995 ,
827                    month 5 ,
828                    day 19 } ,
829                volume "270" ,
830                issue "20" ,
831                pages "11711-11714" ,
832                language "eng" ,
833                pubstatus ppublish ,
834                history {
835                  {
836                    pubstatus pubmed ,
837                    date
838                      std {
839                        year 1995 ,
840                        month 5 ,
841                        day 19 } } ,
842                  {
843                    pubstatus medline ,
844                    date
845                      std {
846                        year 1995 ,
847                        month 5 ,
848                        day 19 ,
849                        hour 0 ,
850                        minute 1 } } } } } ,
851          ids {
852            pubmed 7744812 } } } } ,
853    pub {
854      pub {
855        pmid 7619516 ,
856        article {
857          title {
858            name "Rapsyn may function as a link between the acetylcholine
859 receptor and the agrin-binding dystrophin-associated glycoprotein complex." } ,
860          authors {
861            names
862              std {
863                {
864                  name
865                    name {
866                      last "Apel" ,
867                      initials "E.D." } } ,
868                {
869                  name
870                    name {
871                      last "Roberds" ,
872                      initials "S.L." } } ,
873                {
874                  name
875                    name {
876                      last "Campbell" ,
877                      initials "K.P." } } ,
878                {
879                  name
880                    name {
881                      last "Merlie" ,
882                      initials "J.P." } } } ,
883            affil
884              str "Department of Molecular Biology and Pharmacology,
885 Washington University School of Medicine, St. Louis, Missouri 63110, USA." } ,
886          from
887            journal {
888              title {
889                iso-jta "Neuron" ,
890                ml-jta "Neuron" ,
891                issn "0896-6273" ,
892                name "Neuron" } ,
893              imp {
894                date
895                  std {
896                    year 1995 ,
897                    month 7 } ,
898                volume "15" ,
899                issue "1" ,
900                pages "115-126" ,
901                language "eng" ,
902                pubstatus ppublish ,
903                history {
904                  {
905                    pubstatus pubmed ,
906                    date
907                      std {
908                        year 1995 ,
909                        month 7 ,
910                        day 1 } } ,
911                  {
912                    pubstatus medline ,
913                    date
914                      std {
915                        year 1995 ,
916                        month 7 ,
917                        day 1 ,
918                        hour 0 ,
919                        minute 1 } } } } } ,
920          ids {
921            pubmed 7619516 ,
922            pii "0896-6273(95)90069-1" } } } } ,
923    pub {
924      pub {
925        pmid 1741056 ,
926        article {
927          title {
928            name "Primary structure of dystrophin-associated glycoproteins
929 linking dystrophin to the extracellular matrix." } ,
930          authors {
931            names
932              std {
933                {
934                  name
935                    name {
936                      last "Ibraghimov-Beskrovnaya" ,
937                      initials "O." } } ,
938                {
939                  name
940                    name {
941                      last "Ervasti" ,
942                      initials "J.M." } } ,
943                {
944                  name
945                    name {
946                      last "Leveille" ,
947                      initials "C.J." } } ,
948                {
949                  name
950                    name {
951                      last "Slaughter" ,
952                      initials "C.A." } } ,
953                {
954                  name
955                    name {
956                      last "Sernett" ,
957                      initials "S.W." } } ,
958                {
959                  name
960                    name {
961                      last "Campbell" ,
962                      initials "K.P." } } } ,
963            affil
964              str "Howard Hughes Medical Institute, University of Iowa College
965 of Medicine, Iowa City 52242." } ,
966          from
967            journal {
968              title {
969                iso-jta "Nature" ,
970                ml-jta "Nature" ,
971                issn "0028-0836" ,
972                name "Nature" } ,
973              imp {
974                date
975                  std {
976                    year 1992 ,
977                    month 2 ,
978                    day 20 } ,
979                volume "355" ,
980                issue "6362" ,
981                pages "696-702" ,
982                language "eng" ,
983                pubstatus ppublish ,
984                history {
985                  {
986                    pubstatus pubmed ,
987                    date
988                      std {
989                        year 1992 ,
990                        month 2 ,
991                        day 20 } } ,
992                  {
993                    pubstatus medline ,
994                    date
995                      std {
996                        year 1992 ,
997                        month 2 ,
998                        day 20 ,
999                        hour 0 ,
1000                        minute 1 } } } } } ,
1001          ids {
1002            pubmed 1741056 ,
1003            doi "10.1038/355696a0" } } } } ,
1004    pub {
1005      pub {
1006        pmid 1406935 ,
1007        article {
1008          title {
1009            name "Deficiency of the 50K dystrophin-associated glycoprotein in
1010 severe childhood autosomal recessive muscular dystrophy." } ,
1011          authors {
1012            names
1013              std {
1014                {
1015                  name
1016                    name {
1017                      last "Matsumura" ,
1018                      initials "K." } } ,
1019                {
1020                  name
1021                    name {
1022                      last "Tome" ,
1023                      initials "F.M." } } ,
1024                {
1025                  name
1026                    name {
1027                      last "Collin" ,
1028                      initials "H." } } ,
1029                {
1030                  name
1031                    name {
1032                      last "Azibi" ,
1033                      initials "K." } } ,
1034                {
1035                  name
1036                    name {
1037                      last "Chaouch" ,
1038                      initials "M." } } ,
1039                {
1040                  name
1041                    name {
1042                      last "Kaplan" ,
1043                      initials "J.C." } } ,
1044                {
1045                  name
1046                    name {
1047                      last "Fardeau" ,
1048                      initials "M." } } ,
1049                {
1050                  name
1051                    name {
1052                      last "Campbell" ,
1053                      initials "K.P." } } } ,
1054            affil
1055              str "Howard Hughes Medical Institute, University of Iowa College
1056 of Medicine, Iowa City 52242." } ,
1057          from
1058            journal {
1059              title {
1060                iso-jta "Nature" ,
1061                ml-jta "Nature" ,
1062                issn "0028-0836" ,
1063                name "Nature" } ,
1064              imp {
1065                date
1066                  std {
1067                    year 1992 ,
1068                    month 9 ,
1069                    day 24 } ,
1070                volume "359" ,
1071                issue "6393" ,
1072                pages "320-322" ,
1073                language "eng" ,
1074                pubstatus ppublish ,
1075                history {
1076                  {
1077                    pubstatus pubmed ,
1078                    date
1079                      std {
1080                        year 1992 ,
1081                        month 9 ,
1082                        day 24 } } ,
1083                  {
1084                    pubstatus medline ,
1085                    date
1086                      std {
1087                        year 1992 ,
1088                        month 9 ,
1089                        day 24 ,
1090                        hour 0 ,
1091                        minute 1 } } } } } ,
1092          ids {
1093            pubmed 1406935 ,
1094            doi "10.1038/359320a0" } } } } ,
1095    update-date
1096      std {
1097        year 2008 ,
1098        month 2 ,
1099        day 11 } } ,
1100  seq-set {
1101    seq {
1102      id {
1103        other {
1104          accession "NM_004393" ,
1105          version 2 } ,
1106        gi 148539834 } ,
1107      descr {
1108        molinfo {
1109          biomol mRNA ,
1110          completeness has-right } ,
1111        title "Homo sapiens dystroglycan 1 (dystrophin-associated glycoprotein
1112 1) (DAG1), mRNA" ,
1113        create-date
1114          std {
1115            year 1999 ,
1116            month 5 ,
1117            day 7 } } ,
1118      inst {
1119        repr raw ,
1120        mol rna ,
1121        length 5537 ,
1122        seq-data
1123          ncbi2na '2920969A6668494B69966689E967A3E9E411D9BB4A6BE729D696665595F
112499D265774595AC6E76660A79A6699D9977CA7E9AE9A69A49F6658355AA269AE9A6D7AA528A2604
11255E59AD7565A67A9DEEE75A8E892BB922AE20549DEA142D1F9F5F1F2421CD87E2407E85EA38A3B7
1126BA977679E79577AA8A17F75D79DDEEBCE9D2D51E952E05748A7B4A87A80149F8A4D4E474B9DD21
11277518A7BD512EBE93D78E91A7B6DA99D3F62E14F5048FE3E5D4BA2334D0ACD2692A0A29FE537E9E
112847A8744894457A2A5D55F8478C2AEE4F13F4B899C469EAA506A251355485D4BBBDD4D8ADC57821
112944B89E4B6B8A125D54857AE2BACD3797B9E68E05EE1EFF86B8FFA396174508E15409028F85D791
113028E689F7482C89F441380F2E5AEB8304873F84EDA5F4E9E95A80E4002BAE883AA57DDD7A09EA79
1131D5E05204BB9784F4EBB2295794A8A990EDE749FA715EEBABE913650C20955DF54066D68A48D4E7
1132115117B4794FA955051A735289553528DB941551375253E75D412214E9D752D2A35EF5EA0151AD
113314D68762994F3D015415CA553525C76AED209E9144BD7A523D95063853D7A73BA25C792F9C55D5
1134105145082518B351140149065F41E1D4514518764A50508051A115694B956AD14502FD4D148FA0
11351E5D165C76CF6451452E8B956E9A205414995227420533E12AC8E5EAFA45C7F8AE08D5B4847F73
11368538A11451E109E09E15E01E6A24927AEA620B5EAC4BD04904949D3B3A5F56124946EA40462CFD
1137393944842AA97B69EE8E5F62351B51299550AA32A75E42BD0A50BFBAB85691EBBE0E13510823E5
1138FAC0807A5F65FE885807B2453457920CD15AA7536EBA0E8504111E57E895E550A248D9EA78965A
11393678A38E801769797DD4195C89787F0A5109347B86A77A4BEDA45C4BF357BAC515288B95D22996
114054482E5E12A15E20892E28E3B7179112D3D696EBAD92535E74F9E934F94E379C59082682A427C5
11417E2852945F4D082AAE5CD37F92181E861D42554575D4939474F7928A20A755C5575E2C550522EE
11425621475DE0528453A88B119579A8E28D50E65D5C52554595F449153A2A42A756D50813855316B4
11435D7573B545F0564265EAE8A4AB2A4AA5E88613AEFB7BA216BA5E4853E545A89611785C9111E112
1144A97A109595DDEB5D501540927A221FEA87FFCFFCFFF97049FFAFEF4C883DF67D3FF8E9E9DE0245
11453BA2E8AE8A898A0538381D9292E5A9A557A7779BFE5FC11C1EC7BFFDCF46EEDC9E4A3B04E8012C
11461C08F03D0287F482F0AF0BFF1BF0DE7BF1701FB3B30FFEAEACEA83E7F9C00C2754ABBF407C8821
114742A12CFFF340A0C73FFD11C6D07EBE778C55225E3EAA5D5A57A74650B57AE7ABF9DD59EF94AA7A
114809E8AADDFA94E84D547D4953B11CBA546142AB7D3F53800A87508A4BAE9EE95507FAE752AEA527
11499FBAA917A8AD02B75144D05CFFBFC57FF7B93EFFFFFD75C0283346BFFE011D2EAA13FEB82390CF
1150FCED3B8E77F5D1F85FA59FED704B512D795615154D5FF77A4752D5297EA5E071E802B7A69EA8A2
1151E52432F4C30037BC9DD0270FFF1C0BFF3125D03EFF3C00023F00EB8E7C492FEC6277C2EF8F53A0
11527869FE7EFF8F7FD55C7FD70EBF03DE83C47AAF7FE5FFF248135B5B5379377B54E1D2A9951DE7D8
1153F75D7BA08053FE24E1FF7E3B7826F3FEAC7FF2A28397F6430ECD4F578F8ABABABA1529D5FE4448
11549271F7094CD87BFE48A3FBBB9E5D28AA2A7ACA2AAA22B77B5C79DD48A93F55F997DD512A549577
115555E552D54AAB1DE8B892E55EEAA25EC0E6A74BA147AE1EA74E5D42D22FD5EB954884A2442EA378
11565EB88F3F78E174D000C043D50EF52B8A9FE0297D4049D6D957241D453EA4794E4886E9E9520E97
1157BE53241E8A63AA4B8120C104904397F92925E755E267A9EB8EB6FA1DEE23A2250DD13D0BBD1414
115878EEFFCFD7DCCE3FC23BBFDE4F7B020133407030092EDFCF10000000000'H ,
1159        hist {
1160          assembly {
1161            {
1162              type partial ,
1163              dim 2 ,
1164              segs
1165                denseg {
1166                  dim 2 ,
1167                  numseg 1 ,
1168                  ids {
1169                    gi 148539834 ,
1170                    gi 81455866 } ,
1171                  starts {
1172                    0 ,
1173                    0 } ,
1174                  lens {
1175                    65 } ,
1176                  strands {
1177                    plus ,
1178                    plus } } } ,
1179            {
1180              type partial ,
1181              dim 2 ,
1182              segs
1183                denseg {
1184                  dim 2 ,
1185                  numseg 1 ,
1186                  ids {
1187                    gi 148539834 ,
1188                    gi 33877876 } ,
1189                  starts {
1190                    65 ,
1191                    0 } ,
1192                  lens {
1193                    2608 } ,
1194                  strands {
1195                    plus ,
1196                    plus } } } ,
1197            {
1198              type partial ,
1199              dim 2 ,
1200              segs
1201                denseg {
1202                  dim 2 ,
1203                  numseg 1 ,
1204                  ids {
1205                    gi 148539834 ,
1206                    gi 398025 } ,
1207                  starts {
1208                    2673 ,
1209                    2649 } ,
1210                  lens {
1211                    1 } ,
1212                  strands {
1213                    plus ,
1214                    plus } } } ,
1215            {
1216              type partial ,
1217              dim 2 ,
1218              segs
1219                denseg {
1220                  dim 2 ,
1221                  numseg 1 ,
1222                  ids {
1223                    gi 148539834 ,
1224                    gi 33877876 } ,
1225                  starts {
1226                    2674 ,
1227                    2609 } ,
1228                  lens {
1229                    1708 } ,
1230                  strands {
1231                    plus ,
1232                    plus } } } ,
1233            {
1234              type partial ,
1235              dim 2 ,
1236              segs
1237                denseg {
1238                  dim 2 ,
1239                  numseg 1 ,
1240                  ids {
1241                    gi 148539834 ,
1242                    gi 58554642 } ,
1243                  starts {
1244                    4382 ,
1245                    97 } ,
1246                  lens {
1247                    491 } ,
1248                  strands {
1249                    plus ,
1250                    plus } } } ,
1251            {
1252              type partial ,
1253              dim 2 ,
1254              segs
1255                denseg {
1256                  dim 2 ,
1257                  numseg 1 ,
1258                  ids {
1259                    gi 148539834 ,
1260                    gi 46844012 } ,
1261                  starts {
1262                    4873 ,
1263                    199 } ,
1264                  lens {
1265                    494 } ,
1266                  strands {
1267                    plus ,
1268                    plus } } } ,
1269            {
1270              type partial ,
1271              dim 2 ,
1272              segs
1273                denseg {
1274                  dim 2 ,
1275                  numseg 1 ,
1276                  ids {
1277                    gi 148539834 ,
1278                    gi 11547519 } ,
1279                  starts {
1280                    5367 ,
1281                    0 } ,
1282                  lens {
1283                    152 } ,
1284                  strands {
1285                    plus ,
1286                    minus } } } ,
1287            {
1288              type partial ,
1289              dim 2 ,
1290              segs
1291                denseg {
1292                  dim 2 ,
1293                  numseg 1 ,
1294                  ids {
1295                    gi 148539834 ,
1296                    gi 6503484 } ,
1297                  starts {
1298                    5519 ,
1299                    0 } ,
1300                  lens {
1301                    18 } ,
1302                  strands {
1303                    plus ,
1304                    minus } } } } ,
1305          replaces {
1306            date
1307              std {
1308                year 2007 ,
1309                month 6 ,
1310                day 2 } ,
1311            ids {
1312              gi 4758115 } } } } ,
1313      annot {
1314        {
1315          data
1316            ftable {
1317              {
1318                data
1319                  imp {
1320                    key "polyA_signal" } ,
1321                location
1322                  int {
1323                    from 4347 ,
1324                    to 4352 ,
1325                    strand plus ,
1326                    id
1327                      gi 148539834 } } ,
1328              {
1329                data
1330                  imp {
1331                    key "polyA_site" } ,
1332                location
1333                  pnt {
1334                    point 4387 ,
1335                    strand plus ,
1336                    id
1337                      gi 148539834 } } ,
1338              {
1339                data
1340                  imp {
1341                    key "polyA_signal" } ,
1342                location
1343                  int {
1344                    from 5497 ,
1345                    to 5502 ,
1346                    strand plus ,
1347                    id
1348                      gi 148539834 } } ,
1349              {
1350                data
1351                  imp {
1352                    key "polyA_site" } ,
1353                location
1354                  pnt {
1355                    point 5521 ,
1356                    strand plus ,
1357                    id
1358                      gi 148539834 } } ,
1359              {
1360                data
1361                  gene {
1362                    locus "DAG1" ,
1363                    desc "dystroglycan 1 (dystrophin-associated glycoprotein
1364 1)" ,
1365                    syn {
1366                      "A3a" ,
1367                      "DAG" ,
1368                      "AGRNR" ,
1369                      "156DAG" } } ,
1370                location
1371                  int {
1372                    from 0 ,
1373                    to 5536 ,
1374                    strand plus ,
1375                    id
1376                      gi 148539834 } ,
1377                dbxref {
1378                  {
1379                    db "GeneID" ,
1380                    tag
1381                      id 1605 } ,
1382                  {
1383                    db "HGNC" ,
1384                    tag
1385                      id 2666 } ,
1386                  {
1387                    db "HPRD" ,
1388                    tag
1389                      str "HPRD_00546" } ,
1390                  {
1391                    db "MIM" ,
1392                    tag
1393                      id 128239 } } } } } ,
1394        {
1395          db other ,
1396          name "Annot:STS" ,
1397          data
1398            ftable {
1399              {
1400                data
1401                  imp {
1402                    key "STS" } ,
1403                location
1404                  int {
1405                    from 1789 ,
1406                    to 2667 ,
1407                    strand plus ,
1408                    id
1409                      gi 148539834 } ,
1410                qual {
1411                  {
1412                    qual "standard_name" ,
1413                    val "PMC28400P1" } } ,
1414                dbxref {
1415                  {
1416                    db "UniSTS" ,
1417                    tag
1418                      id 272410 } } } ,
1419              {
1420                data
1421                  imp {
1422                    key "STS" } ,
1423                location
1424                  int {
1425                    from 3429 ,
1426                    to 3771 ,
1427                    strand plus ,
1428                    id
1429                      gi 148539834 } ,
1430                qual {
1431                  {
1432                    qual "standard_name" ,
1433                    val "D3S3337" } } ,
1434                dbxref {
1435                  {
1436                    db "UniSTS" ,
1437                    tag
1438                      id 5975 } } } ,
1439              {
1440                data
1441                  imp {
1442                    key "STS" } ,
1443                location
1444                  int {
1445                    from 2630 ,
1446                    to 2791 ,
1447                    strand plus ,
1448                    id
1449                      gi 148539834 } ,
1450                qual {
1451                  {
1452                    qual "standard_name" ,
1453                    val "GDB:215839" } } ,
1454                dbxref {
1455                  {
1456                    db "UniSTS" ,
1457                    tag
1458                      id 156205 } } } ,
1459              {
1460                data
1461                  imp {
1462                    key "STS" } ,
1463                location
1464                  int {
1465                    from 4139 ,
1466                    to 4265 ,
1467                    strand plus ,
1468                    id
1469                      gi 148539834 } ,
1470                qual {
1471                  {
1472                    qual "standard_name" ,
1473                    val "Bdy62f05" } } ,
1474                dbxref {
1475                  {
1476                    db "UniSTS" ,
1477                    tag
1478                      id 36695 } } } ,
1479              {
1480                data
1481                  imp {
1482                    key "STS" } ,
1483                location
1484                  int {
1485                    from 4553 ,
1486                    to 4707 ,
1487                    strand plus ,
1488                    id
1489                      gi 148539834 } ,
1490                qual {
1491                  {
1492                    qual "standard_name" ,
1493                    val "G54125" } } ,
1494                dbxref {
1495                  {
1496                    db "UniSTS" ,
1497                    tag
1498                      id 109362 } } } } } ,
1499        {
1500          db other ,
1501          name "Annot:Exon" ,
1502          desc {
1503            title "NM exons based on Splign alignments" } ,
1504          data
1505            ftable {
1506              {
1507                data
1508                  imp {
1509                    key "exon" } ,
1510                location
1511                  int {
1512                    from 0 ,
1513                    to 301 ,
1514                    strand plus ,
1515                    id
1516                      gi 148539834 } ,
1517                qual {
1518                  {
1519                    qual "number" ,
1520                    val "1" } ,
1521                  {
1522                    qual "inference" ,
1523                    val "alignment:Splign" } } } ,
1524              {
1525                data
1526                  imp {
1527                    key "exon" } ,
1528                location
1529                  int {
1530                    from 302 ,
1531                    to 702 ,
1532                    strand plus ,
1533                    id
1534                      gi 148539834 } ,
1535                qual {
1536                  {
1537                    qual "number" ,
1538                    val "2" } ,
1539                  {
1540                    qual "inference" ,
1541                    val "alignment:Splign" } } } ,
1542              {
1543                data
1544                  imp {
1545                    key "exon" } ,
1546                location
1547                  int {
1548                    from 703 ,
1549                    to 5521 ,
1550                    strand plus ,
1551                    id
1552                      gi 148539834 } ,
1553                qual {
1554                  {
1555                    qual "number" ,
1556                    val "3" } ,
1557                  {
1558                    qual "inference" ,
1559                    val "alignment:Splign" } } } } } } } ,
1560    seq {
1561      id {
1562        other {
1563          accession "NP_004384" ,
1564          version 2 } ,
1565        gi 148539835 } ,
1566      descr {
1567        molinfo {
1568          biomol peptide } ,
1569        title "dystroglycan 1 preproprotein [Homo sapiens]" ,
1570        create-date
1571          std {
1572            year 1999 ,
1573            month 5 ,
1574            day 7 } } ,
1575      inst {
1576        repr raw ,
1577        mol aa ,
1578        length 895 ,
1579        seq-data
1580          ncbieaa "MRMSVGLSLLLPLWGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHE
1581AVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATR
1582LGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMR
1583SFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYP
1584VVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIR
1585TRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTTTKKPRVSTPKPATPSTDSTTTTTRRP
1586TKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHE
1587DTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAP
1588ARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAE
1589DDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVA
1590AILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPET
1591TPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP" ,
1592        hist {
1593          replaces {
1594            date
1595              std {
1596                year 2007 ,
1597                month 6 ,
1598                day 2 } ,
1599            ids {
1600              gi 4758116 } } } } ,
1601      annot {
1602        {
1603          data
1604            ftable {
1605              {
1606                data
1607                  prot {
1608                    processed signal-peptide } ,
1609                location
1610                  int {
1611                    from 0 ,
1612                    to 28 ,
1613                    id
1614                      gi 148539835 } } ,
1615              {
1616                data
1617                  prot {
1618                    name {
1619                      "dystroglycan 1 proprotein" } ,
1620                    processed preprotein } ,
1621                location
1622                  int {
1623                    from 29 ,
1624                    to 894 ,
1625                    id
1626                      gi 148539835 } } ,
1627              {
1628                data
1629                  prot {
1630                    name {
1631                      "alpha-dystroglycan" } ,
1632                    processed mature } ,
1633                location
1634                  int {
1635                    from 29 ,
1636                    to 652 ,
1637                    id
1638                      gi 148539835 } } ,
1639              {
1640                data
1641                  prot {
1642                    name {
1643                      "beta-dystroglycan" } ,
1644                    processed mature } ,
1645                location
1646                  int {
1647                    from 653 ,
1648                    to 894 ,
1649                    id
1650                      gi 148539835 } } ,
1651              {
1652                data
1653                  prot {
1654                    name {
1655                      "dystroglycan 1 preproprotein" ,
1656                      "alpha-dystroglycan" ,
1657                      "dystrophin-associated glycoprotein-1" ,
1658                      "beta-dystroglycan" } } ,
1659                location
1660                  int {
1661                    from 0 ,
1662                    to 894 ,
1663                    id
1664                      gi 148539835 } } } } ,
1665        {
1666          db other ,
1667          name "Annot:CDD" ,
1668          desc {
1669            name "CDDSearch" ,
1670            create-date
1671              std {
1672                year 2007 ,
1673                month 6 ,
1674                day 5 ,
1675                hour 13 ,
1676                minute 47 ,
1677                second 25 } } ,
1678          data
1679            ftable {
1680              {
1681                data
1682                  region "CADG" ,
1683                comment "Dystroglycan-type cadherin-like domains.
1684 Cadherin-homologous domains present in metazoan dystroglycans and
1685 alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from
1686 magnetotactic bacteria. Likely to bind calcium ions." ,
1687                location
1688                  int {
1689                    from 498 ,
1690                    to 598 ,
1691                    id
1692                      gi 148539835 } ,
1693                ext {
1694                  type
1695                    str "cddScoreData" ,
1696                  data {
1697                    {
1698                      label
1699                        str "definition" ,
1700                      data
1701                        str "smart00736" } ,
1702                    {
1703                      label
1704                        str "short_name" ,
1705                      data
1706                        str "CADG" } ,
1707                    {
1708                      label
1709                        str "score" ,
1710                      data
1711                        int 188 } ,
1712                    {
1713                      label
1714                        str "evalue" ,
1715                      data
1716                        real { 164132, 10, -19 } } ,
1717                    {
1718                      label
1719                        str "bit_score" ,
1720                      data
1721                        real { 765172, 10, -4 } } } } ,
1722                dbxref {
1723                  {
1724                    db "CDD" ,
1725                    tag
1726                      id 48003 } } } ,
1727              {
1728                data
1729                  region "CADG" ,
1730                comment "Dystroglycan-type cadherin-like domains.
1731 Cadherin-homologous domains present in metazoan dystroglycans and
1732 alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from
1733 magnetotactic bacteria. Likely to bind calcium ions." ,
1734                location
1735                  int {
1736                    from 63 ,
1737                    to 161 ,
1738                    id
1739                      gi 148539835 } ,
1740                ext {
1741                  type
1742                    str "cddScoreData" ,
1743                  data {
1744                    {
1745                      label
1746                        str "definition" ,
1747                      data
1748                        str "smart00736" } ,
1749                    {
1750                      label
1751                        str "short_name" ,
1752                      data
1753                        str "CADG" } ,
1754                    {
1755                      label
1756                        str "score" ,
1757                      data
1758                        int 177 } ,
1759                    {
1760                      label
1761                        str "evalue" ,
1762                      data
1763                        real { 285713, 10, -18 } } ,
1764                    {
1765                      label
1766                        str "bit_score" ,
1767                      data
1768                        real { 7228, 10, -2 } } } } ,
1769                dbxref {
1770                  {
1771                    db "CDD" ,
1772                    tag
1773                      id 48003 } } } ,
1774              {
1775                data
1776                  region "DAG1" ,
1777                partial TRUE ,
1778                comment "Dystroglycan (Dystrophin-associated glycoprotein 1).
1779 Dystroglycan is one of the dystrophin-associated glycoproteins, which is
1780 encoded by a 5.5 kb transcript in human." ,
1781                location
1782                  int {
1783                    from 467 ,
1784                    to 883 ,
1785                    id
1786                      gi 148539835 ,
1787                    fuzz-from
1788                      lim lt } ,
1789                ext {
1790                  type
1791                    str "cddScoreData" ,
1792                  data {
1793                    {
1794                      label
1795                        str "definition" ,
1796                      data
1797                        str "pfam05454" } ,
1798                    {
1799                      label
1800                        str "short_name" ,
1801                      data
1802                        str "DAG1" } ,
1803                    {
1804                      label
1805                        str "score" ,
1806                      data
1807                        int 1364 } ,
1808                    {
1809                      label
1810                        str "evalue" ,
1811                      data
1812                        real { 643304, 10, -156 } } ,
1813                    {
1814                      label
1815                        str "bit_score" ,
1816                      data
1817                        real { 52977, 10, -2 } } } } ,
1818                dbxref {
1819                  {
1820                    db "CDD" ,
1821                    tag
1822                      id 69003 } } } ,
1823              {
1824                data
1825                  region "DAG1" ,
1826                partial TRUE ,
1827                comment "Dystroglycan (Dystrophin-associated glycoprotein 1).
1828 Dystroglycan is one of the dystrophin-associated glycoproteins, which is
1829 encoded by a 5.5 kb transcript in human." ,
1830                location
1831                  int {
1832                    from 41 ,
1833                    to 411 ,
1834                    id
1835                      gi 148539835 ,
1836                    fuzz-to
1837                      lim gt } ,
1838                ext {
1839                  type
1840                    str "cddScoreData" ,
1841                  data {
1842                    {
1843                      label
1844                        str "definition" ,
1845                      data
1846                        str "pfam05454" } ,
1847                    {
1848                      label
1849                        str "short_name" ,
1850                      data
1851                        str "DAG1" } ,
1852                    {
1853                      label
1854                        str "score" ,
1855                      data
1856                        int 1303 } ,
1857                    {
1858                      label
1859                        str "evalue" ,
1860                      data
1861                        real { 62179, 10, -148 } } ,
1862                    {
1863                      label
1864                        str "bit_score" ,
1865                      data
1866                        real { 506273, 10, -3 } } } } ,
1867                dbxref {
1868                  {
1869                    db "CDD" ,
1870                    tag
1871                      id 69003 } } } } } } } } ,
1872  annot {
1873    {
1874      data
1875        ftable {
1876          {
1877            data
1878              cdregion {
1879                code {
1880                  id 1 } } ,
1881            product
1882              whole
1883                gi 148539835 ,
1884            location
1885              int {
1886                from 418 ,
1887                to 3105 ,
1888                strand plus ,
1889                id
1890                  gi 148539834 } ,
1891            dbxref {
1892              {
1893                db "CCDS" ,
1894                tag
1895                  str "CCDS2799.1" } } } } } } }
1896