Context Navigation

Back to OpenBio*

OpenBio*: dag1.asn1

File dag1.asn1, 58.0 KB (added by jan.aerts, 17 years ago)
DAG1 gene: ASN.1 formatted file exported from NCBI

Line
1	Seq-entry ::= set {
2	level 1 ,
3	class nuc-prot ,
4	descr {
5	source {
6	genome genomic ,
7	org {
8	taxname "Homo sapiens" ,
9	common "human" ,
10	db {
11	{
12	db "taxon" ,
13	tag
14	id 9606 } } ,
15	orgname {
16	name
17	binomial {
18	genus "Homo" ,
19	species "sapiens" } ,
20	lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
21	Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
22	Catarrhini; Hominidae; Homo" ,
23	gcode 1 ,
24	mgcode 2 ,
25	div "PRI" } } ,
26	subtype {
27	{
28	subtype chromosome ,
29	name "3" } ,
30	{
31	subtype map ,
32	name "3p21" } } } ,
33	comment "~Summary: Dystroglycan is a laminin binding component of the
34	dystrophin-glycoprotein complex which provides a linkage between the
35	subsarcolemmal cytoskeleton and the extracellular matrix. Dystroglycan 1 is a
36	candidate gene for the site of the mutation in autosomal recessive muscular
37	dystrophies. The dramatic reduction of dystroglycan 1 in Duchenne muscular
38	dystrophy leads to a loss of linkage between the sarcolemma and extracellular
39	matrix, rendering muscle fibers more susceptible to necrosis. Dystroglycan
40	also functions as dual receptor for agrin and laminin-2 in the Schwann cell
41	membrane. The muscle and nonmuscle isoforms of dystroglycan differ by
42	carbohydrate moieties but not protein sequence." ,
43	user {
44	type
45	str "RefGeneTracking" ,
46	data {
47	{
48	label
49	str "Status" ,
50	data
51	str "Reviewed" } ,
52	{
53	label
54	str "Assembly" ,
55	data
56	fields {
57	{
58	label
59	id 0 ,
60	data
61	fields {
62	{
63	label
64	str "accession" ,
65	data
66	str "DA851197.1" } } } ,
67	{
68	label
69	id 0 ,
70	data
71	fields {
72	{
73	label
74	str "accession" ,
75	data
76	str "BC012740.2" } ,
77	{
78	label
79	str "gi" ,
80	data
81	int 15215308 } } } ,
82	{
83	label
84	id 0 ,
85	data
86	fields {
87	{
88	label
89	str "accession" ,
90	data
91	str "L19711.1" } ,
92	{
93	label
94	str "gi" ,
95	data
96	int 398026 } } } ,
97	{
98	label
99	id 0 ,
100	data
101	fields {
102	{
103	label
104	str "accession" ,
105	data
106	str "CX871468.1" } } } ,
107	{
108	label
109	id 0 ,
110	data
111	fields {
112	{
113	label
114	str "accession" ,
115	data
116	str "BX402174.2" } } } ,
117	{
118	label
119	id 0 ,
120	data
121	fields {
122	{
123	label
124	str "accession" ,
125	data
126	str "BF476692.1" } } } ,
127	{
128	label
129	id 0 ,
130	data
131	fields {
132	{
133	label
134	str "accession" ,
135	data
136	str "AW204012.1" } } } } } } } ,
137	comment "~Publication Note: This RefSeq record includes a subset of the
138	publications that are available for this gene. Please see the Entrez Gene
139	record to access additional publications." ,
140	pub {
141	pub {
142	pmid 17640712 ,
143	article {
144	title {
145	name "Altered expression of natively glycosylated alpha
146	dystroglycan in pediatric solid tumors." } ,
147	authors {
148	names
149	std {
150	{
151	name
152	name {
153	last "Martin" ,
154	initials "L.T." } } ,
155	{
156	name
157	name {
158	last "Glass" ,
159	initials "M." } } ,
160	{
161	name
162	name {
163	last "Dosunmu" ,
164	initials "E." } } ,
165	{
166	name
167	name {
168	last "Martin" ,
169	initials "P.T." } } } ,
170	affil
171	str "Division of Pediatric Hematology/Oncology, Department of
172	Pediatrics, Ohio State University College of Medicine and Public Health,
173	Columbus, OH 43205, USA. martinlt@pediatrics.ohio-state.edu" } ,
174	from
175	journal {
176	title {
177	iso-jta "Hum. Pathol." ,
178	ml-jta "Hum Pathol" ,
179	issn "0046-8177" ,
180	name "Human pathology" } ,
181	imp {
182	date
183	std {
184	year 2007 ,
185	month 11 } ,
186	volume "38" ,
187	issue "11" ,
188	pages "1657-1668" ,
189	language "eng" ,
190	pubstatus ppublish ,
191	history {
192	{
193	pubstatus received ,
194	date
195	std {
196	year 2006 ,
197	month 7 ,
198	day 10 } } ,
199	{
200	pubstatus revised ,
201	date
202	std {
203	year 2006 ,
204	month 11 ,
205	day 28 } } ,
206	{
207	pubstatus accepted ,
208	date
209	std {
210	year 2007 ,
211	month 3 ,
212	day 12 } } ,
213	{
214	pubstatus aheadofprint ,
215	date
216	std {
217	year 2007 ,
218	month 7 ,
219	day 19 } } ,
220	{
221	pubstatus pubmed ,
222	date
223	std {
224	year 2007 ,
225	month 7 ,
226	day 21 ,
227	hour 9 ,
228	minute 0 } } ,
229	{
230	pubstatus medline ,
231	date
232	std {
233	year 2007 ,
234	month 12 ,
235	day 21 ,
236	hour 9 ,
237	minute 0 } } } } } ,
238	ids {
239	pii "S0046-8177(07)00162-1" ,
240	doi "10.1016/j.humpath.2007.03.025" ,
241	pubmed 17640712 } } } ,
242	comment "GeneRIF: alpha dystroglycan glycosylation & laminin binding to
243	alpha dystroglycan are altered in certain pediatric solid tumors and suggest
244	that aberrant dystroglycan glycosylation may contribute to tumor cell biology
245	in patients with RMS, medulloblastoma, & NBL." } ,
246	pub {
247	pub {
248	pmid 17516554 ,
249	article {
250	title {
251	name "Dystroglycan expression is reduced during prostate
252	tumorigenesis and is regulated by androgens in prostate cancer cells." } ,
253	authors {
254	names
255	std {
256	{
257	name
258	name {
259	last "Sgambato" ,
260	initials "A." } } ,
261	{
262	name
263	name {
264	last "De Paola" ,
265	initials "B." } } ,
266	{
267	name
268	name {
269	last "Migaldi" ,
270	initials "M." } } ,
271	{
272	name
273	name {
274	last "Di Salvatore" ,
275	initials "M." } } ,
276	{
277	name
278	name {
279	last "Rettino" ,
280	initials "A." } } ,
281	{
282	name
283	name {
284	last "Rossi" ,
285	initials "G." } } ,
286	{
287	name
288	name {
289	last "Faraglia" ,
290	initials "B." } } ,
291	{
292	name
293	name {
294	last "Boninsegna" ,
295	initials "A." } } ,
296	{
297	name
298	name {
299	last "Maiorana" ,
300	initials "A." } } ,
301	{
302	name
303	name {
304	last "Cittadini" ,
305	initials "A." } } } ,
306	affil
307	str "Laboratorio di Oncologia Molecolare, Centro di Riferimento
308	Oncologico di Basilicata, Rionero in Vulture (PZ), Italy.
309	asgambato@rm.unicatt.it" } ,
310	from
311	journal {
312	title {
313	iso-jta "J. Cell. Physiol." ,
314	ml-jta "J Cell Physiol" ,
315	issn "0021-9541" ,
316	name "Journal of cellular physiology" } ,
317	imp {
318	date
319	std {
320	year 2007 ,
321	month 11 } ,
322	volume "213" ,
323	issue "2" ,
324	pages "528-539" ,
325	language "eng" ,
326	pubstatus ppublish ,
327	history {
328	{
329	pubstatus pubmed ,
330	date
331	std {
332	year 2007 ,
333	month 5 ,
334	day 23 ,
335	hour 9 ,
336	minute 0 } } ,
337	{
338	pubstatus medline ,
339	date
340	std {
341	year 2008 ,
342	month 1 ,
343	day 23 ,
344	hour 9 ,
345	minute 0 } } } } } ,
346	ids {
347	doi "10.1002/jcp.21130" ,
348	pubmed 17516554 } } } ,
349	comment "GeneRIF: Data suggest that disturbances in the function of the
350	dystroglycan complex might contribute to the definition of the malignant
351	behavior of prostate cancer cells and suggest that androgens might regulate
352	DG expression in these cells." } ,
353	pub {
354	pub {
355	pmid 17012237 ,
356	article {
357	title {
358	name "Activation of muscle-specific receptor tyrosine kinase and
359	binding to dystroglycan are regulated by alternative mRNA splicing of agrin." } ,
360	authors {
361	names
362	std {
363	{
364	name
365	name {
366	last "Scotton" ,
367	initials "P." } } ,
368	{
369	name
370	name {
371	last "Bleckmann" ,
372	initials "D." } } ,
373	{
374	name
375	name {
376	last "Stebler" ,
377	initials "M." } } ,
378	{
379	name
380	name {
381	last "Sciandra" ,
382	initials "F." } } ,
383	{
384	name
385	name {
386	last "Brancaccio" ,
387	initials "A." } } ,
388	{
389	name
390	name {
391	last "Meier" ,
392	initials "T." } } ,
393	{
394	name
395	name {
396	last "Stetefeld" ,
397	initials "J." } } ,
398	{
399	name
400	name {
401	last "Ruegg" ,
402	initials "M.A." } } } ,
403	affil
404	str "Biozentrum, University of Basel, Klingelbergstrasse 70,
405	CH-4056 Basel, Switzerland." } ,
406	from
407	journal {
408	title {
409	iso-jta "J. Biol. Chem." ,
410	ml-jta "J Biol Chem" ,
411	issn "0021-9258" ,
412	name "The Journal of biological chemistry" } ,
413	imp {
414	date
415	std {
416	year 2006 ,
417	month 12 ,
418	day 1 } ,
419	volume "281" ,
420	issue "48" ,
421	pages "36835-36845" ,
422	language "eng" ,
423	pubstatus ppublish ,
424	history {
425	{
426	pubstatus aheadofprint ,
427	date
428	std {
429	year 2006 ,
430	month 9 ,
431	day 29 } } ,
432	{
433	pubstatus pubmed ,
434	date
435	std {
436	year 2006 ,
437	month 10 ,
438	day 3 ,
439	hour 9 ,
440	minute 0 } } ,
441	{
442	pubstatus medline ,
443	date
444	std {
445	year 2007 ,
446	month 1 ,
447	day 31 ,
448	hour 9 ,
449	minute 0 } } } } } ,
450	ids {
451	pii "M607887200" ,
452	doi "10.1074/jbc.M607887200" ,
453	pubmed 17012237 } } } ,
454	comment "GeneRIF: muscle-specific receptor tyrosine kinase activation
455	and binding to dystroglycan are regulated by alternative mRNA splicing of
456	agrin" } ,
457	pub {
458	pub {
459	pmid 17005282 ,
460	article {
461	title {
462	name "Intracellular binding of fukutin and alpha-dystroglycan:
463	relation to glycosylation of alpha-dystroglycan." } ,
464	authors {
465	names
466	std {
467	{
468	name
469	name {
470	last "Yamamoto" ,
471	initials "T." } } ,
472	{
473	name
474	name {
475	last "Kawaguchi" ,
476	initials "M." } } ,
477	{
478	name
479	name {
480	last "Sakayori" ,
481	initials "N." } } ,
482	{
483	name
484	name {
485	last "Muramatsu" ,
486	initials "F." } } ,
487	{
488	name
489	name {
490	last "Morikawa" ,
491	initials "S." } } ,
492	{
493	name
494	name {
495	last "Kato" ,
496	initials "Y." } } ,
497	{
498	name
499	name {
500	last "Shibata" ,
501	initials "N." } } ,
502	{
503	name
504	name {
505	last "Kobayashi" ,
506	initials "M." } } } ,
507	affil
508	str "Department of Pathology, Tokyo Women's Medical University,
509	Tokyo, Japan. sheto@research.twmu.ac.jp" } ,
510	from
511	journal {
512	title {
513	iso-jta "Neurosci. Res." ,
514	ml-jta "Neurosci Res" ,
515	issn "0168-0102" ,
516	name "Neuroscience research" } ,
517	imp {
518	date
519	std {
520	year 2006 ,
521	month 12 } ,
522	volume "56" ,
523	issue "4" ,
524	pages "391-399" ,
525	language "eng" ,
526	pubstatus ppublish ,
527	history {
528	{
529	pubstatus received ,
530	date
531	std {
532	year 2006 ,
533	month 1 ,
534	day 21 } } ,
535	{
536	pubstatus revised ,
537	date
538	std {
539	year 2006 ,
540	month 8 ,
541	day 14 } } ,
542	{
543	pubstatus accepted ,
544	date
545	std {
546	year 2006 ,
547	month 8 ,
548	day 17 } } ,
549	{
550	pubstatus aheadofprint ,
551	date
552	std {
553	year 2006 ,
554	month 9 ,
555	day 26 } } ,
556	{
557	pubstatus pubmed ,
558	date
559	std {
560	year 2006 ,
561	month 9 ,
562	day 29 ,
563	hour 9 ,
564	minute 0 } } ,
565	{
566	pubstatus medline ,
567	date
568	std {
569	year 2007 ,
570	month 1 ,
571	day 18 ,
572	hour 9 ,
573	minute 0 } } } } } ,
574	ids {
575	pii "S0168-0102(06)00215-X" ,
576	doi "10.1016/j.neures.2006.08.009" ,
577	pubmed 17005282 } } } ,
578	comment "GeneRIF: Fukutin seems to bind to both the hypoglycosylated and
579	fully glycosylated form of alpha-dystroglycan, and seems bind to the core
580	area rather than the sugar chain of alpha-dystroglycan" } ,
581	pub {
582	pub {
583	pmid 16709410 ,
584	article {
585	title {
586	name "Brain alpha-dystroglycan displays unique glycoepitopes and
587	preferential binding to laminin-10/11." } ,
588	authors {
589	names
590	std {
591	{
592	name
593	name {
594	last "McDearmon" ,
595	initials "E.L." } } ,
596	{
597	name
598	name {
599	last "Combs" ,
600	initials "A.C." } } ,
601	{
602	name
603	name {
604	last "Sekiguchi" ,
605	initials "K." } } ,
606	{
607	name
608	name {
609	last "Fujiwara" ,
610	initials "H." } } ,
611	{
612	name
613	name {
614	last "Ervasti" ,
615	initials "J.M." } } } ,
616	affil
617	str "Department of Physiology, University of Wisconsin, Madison,
618	53706, USA." } ,
619	from
620	journal {
621	title {
622	iso-jta "FEBS Lett." ,
623	ml-jta "FEBS Lett" ,
624	issn "0014-5793" ,
625	name "FEBS letters" } ,
626	imp {
627	date
628	std {
629	year 2006 ,
630	month 6 ,
631	day 12 } ,
632	volume "580" ,
633	issue "14" ,
634	pages "3381-3385" ,
635	language "eng" ,
636	pubstatus ppublish ,
637	history {
638	{
639	pubstatus received ,
640	date
641	std {
642	year 2006 ,
643	month 2 ,
644	day 14 } } ,
645	{
646	pubstatus revised ,
647	date
648	std {
649	year 2006 ,
650	month 4 ,
651	day 18 } } ,
652	{
653	pubstatus accepted ,
654	date
655	std {
656	year 2006 ,
657	month 5 ,
658	day 2 } } ,
659	{
660	pubstatus aheadofprint ,
661	date
662	std {
663	year 2006 ,
664	month 5 ,
665	day 11 } } ,
666	{
667	pubstatus pubmed ,
668	date
669	std {
670	year 2006 ,
671	month 5 ,
672	day 20 ,
673	hour 9 ,
674	minute 0 } } ,
675	{
676	pubstatus medline ,
677	date
678	std {
679	year 2006 ,
680	month 7 ,
681	day 28 ,
682	hour 9 ,
683	minute 0 } } } } } ,
684	ids {
685	pii "S0014-5793(06)00595-3" ,
686	doi "10.1016/j.febslet.2006.05.010" ,
687	pubmed 16709410 } } } } ,
688	pub {
689	pub {
690	pmid 7774920 ,
691	article {
692	title {
693	name "Genetic mapping of the mouse neuromuscular mutation
694	kyphoscoliosis." } ,
695	authors {
696	names
697	std {
698	{
699	name
700	name {
701	last "Skynner" ,
702	initials "M.J." } } ,
703	{
704	name
705	name {
706	last "Gangadharan" ,
707	initials "U." } } ,
708	{
709	name
710	name {
711	last "Coulton" ,
712	initials "G.R." } } ,
713	{
714	name
715	name {
716	last "Mason" ,
717	initials "R.M." } } ,
718	{
719	name
720	name {
721	last "Nikitopoulou" ,
722	initials "A." } } ,
723	{
724	name
725	name {
726	last "Brown" ,
727	initials "S.D." } } ,
728	{
729	name
730	name {
731	last "Blanco" ,
732	initials "G." } } } ,
733	affil
734	str "Department of Biochemistry, Charing Cross and Westminster
735	Hospital Medical School, London, United Kingdom." } ,
736	from
737	journal {
738	title {
739	iso-jta "Genomics" ,
740	ml-jta "Genomics" ,
741	issn "0888-7543" ,
742	name "Genomics" } ,
743	imp {
744	date
745	std {
746	year 1995 ,
747	month 1 ,
748	day 1 } ,
749	volume "25" ,
750	issue "1" ,
751	pages "207-213" ,
752	language "eng" ,
753	pubstatus ppublish ,
754	history {
755	{
756	pubstatus pubmed ,
757	date
758	std {
759	year 1995 ,
760	month 1 ,
761	day 1 } } ,
762	{
763	pubstatus medline ,
764	date
765	std {
766	year 1995 ,
767	month 1 ,
768	day 1 ,
769	hour 0 ,
770	minute 1 } } } } } ,
771	ids {
772	pubmed 7774920 ,
773	pii "0888-7543(95)80127-8" } } } } ,
774	pub {
775	pub {
776	pmid 7744812 ,
777	article {
778	title {
779	name "SH3 domain-mediated interaction of dystroglycan and Grb2." } ,
780	authors {
781	names
782	std {
783	{
784	name
785	name {
786	last "Yang" ,
787	initials "B." } } ,
788	{
789	name
790	name {
791	last "Jung" ,
792	initials "D." } } ,
793	{
794	name
795	name {
796	last "Motto" ,
797	initials "D." } } ,
798	{
799	name
800	name {
801	last "Meyer" ,
802	initials "J." } } ,
803	{
804	name
805	name {
806	last "Koretzky" ,
807	initials "G." } } ,
808	{
809	name
810	name {
811	last "Campbell" ,
812	initials "K.P." } } } ,
813	affil
814	str "Howard Hughes Medical Institute, College of Medicine, Iowa
815	City, Iowa, USA." } ,
816	from
817	journal {
818	title {
819	iso-jta "J. Biol. Chem." ,
820	ml-jta "J Biol Chem" ,
821	issn "0021-9258" ,
822	name "The Journal of biological chemistry" } ,
823	imp {
824	date
825	std {
826	year 1995 ,
827	month 5 ,
828	day 19 } ,
829	volume "270" ,
830	issue "20" ,
831	pages "11711-11714" ,
832	language "eng" ,
833	pubstatus ppublish ,
834	history {
835	{
836	pubstatus pubmed ,
837	date
838	std {
839	year 1995 ,
840	month 5 ,
841	day 19 } } ,
842	{
843	pubstatus medline ,
844	date
845	std {
846	year 1995 ,
847	month 5 ,
848	day 19 ,
849	hour 0 ,
850	minute 1 } } } } } ,
851	ids {
852	pubmed 7744812 } } } } ,
853	pub {
854	pub {
855	pmid 7619516 ,
856	article {
857	title {
858	name "Rapsyn may function as a link between the acetylcholine
859	receptor and the agrin-binding dystrophin-associated glycoprotein complex." } ,
860	authors {
861	names
862	std {
863	{
864	name
865	name {
866	last "Apel" ,
867	initials "E.D." } } ,
868	{
869	name
870	name {
871	last "Roberds" ,
872	initials "S.L." } } ,
873	{
874	name
875	name {
876	last "Campbell" ,
877	initials "K.P." } } ,
878	{
879	name
880	name {
881	last "Merlie" ,
882	initials "J.P." } } } ,
883	affil
884	str "Department of Molecular Biology and Pharmacology,
885	Washington University School of Medicine, St. Louis, Missouri 63110, USA." } ,
886	from
887	journal {
888	title {
889	iso-jta "Neuron" ,
890	ml-jta "Neuron" ,
891	issn "0896-6273" ,
892	name "Neuron" } ,
893	imp {
894	date
895	std {
896	year 1995 ,
897	month 7 } ,
898	volume "15" ,
899	issue "1" ,
900	pages "115-126" ,
901	language "eng" ,
902	pubstatus ppublish ,
903	history {
904	{
905	pubstatus pubmed ,
906	date
907	std {
908	year 1995 ,
909	month 7 ,
910	day 1 } } ,
911	{
912	pubstatus medline ,
913	date
914	std {
915	year 1995 ,
916	month 7 ,
917	day 1 ,
918	hour 0 ,
919	minute 1 } } } } } ,
920	ids {
921	pubmed 7619516 ,
922	pii "0896-6273(95)90069-1" } } } } ,
923	pub {
924	pub {
925	pmid 1741056 ,
926	article {
927	title {
928	name "Primary structure of dystrophin-associated glycoproteins
929	linking dystrophin to the extracellular matrix." } ,
930	authors {
931	names
932	std {
933	{
934	name
935	name {
936	last "Ibraghimov-Beskrovnaya" ,
937	initials "O." } } ,
938	{
939	name
940	name {
941	last "Ervasti" ,
942	initials "J.M." } } ,
943	{
944	name
945	name {
946	last "Leveille" ,
947	initials "C.J." } } ,
948	{
949	name
950	name {
951	last "Slaughter" ,
952	initials "C.A." } } ,
953	{
954	name
955	name {
956	last "Sernett" ,
957	initials "S.W." } } ,
958	{
959	name
960	name {
961	last "Campbell" ,
962	initials "K.P." } } } ,
963	affil
964	str "Howard Hughes Medical Institute, University of Iowa College
965	of Medicine, Iowa City 52242." } ,
966	from
967	journal {
968	title {
969	iso-jta "Nature" ,
970	ml-jta "Nature" ,
971	issn "0028-0836" ,
972	name "Nature" } ,
973	imp {
974	date
975	std {
976	year 1992 ,
977	month 2 ,
978	day 20 } ,
979	volume "355" ,
980	issue "6362" ,
981	pages "696-702" ,
982	language "eng" ,
983	pubstatus ppublish ,
984	history {
985	{
986	pubstatus pubmed ,
987	date
988	std {
989	year 1992 ,
990	month 2 ,
991	day 20 } } ,
992	{
993	pubstatus medline ,
994	date
995	std {
996	year 1992 ,
997	month 2 ,
998	day 20 ,
999	hour 0 ,
1000	minute 1 } } } } } ,
1001	ids {
1002	pubmed 1741056 ,
1003	doi "10.1038/355696a0" } } } } ,
1004	pub {
1005	pub {
1006	pmid 1406935 ,
1007	article {
1008	title {
1009	name "Deficiency of the 50K dystrophin-associated glycoprotein in
1010	severe childhood autosomal recessive muscular dystrophy." } ,
1011	authors {
1012	names
1013	std {
1014	{
1015	name
1016	name {
1017	last "Matsumura" ,
1018	initials "K." } } ,
1019	{
1020	name
1021	name {
1022	last "Tome" ,
1023	initials "F.M." } } ,
1024	{
1025	name
1026	name {
1027	last "Collin" ,
1028	initials "H." } } ,
1029	{
1030	name
1031	name {
1032	last "Azibi" ,
1033	initials "K." } } ,
1034	{
1035	name
1036	name {
1037	last "Chaouch" ,
1038	initials "M." } } ,
1039	{
1040	name
1041	name {
1042	last "Kaplan" ,
1043	initials "J.C." } } ,
1044	{
1045	name
1046	name {
1047	last "Fardeau" ,
1048	initials "M." } } ,
1049	{
1050	name
1051	name {
1052	last "Campbell" ,
1053	initials "K.P." } } } ,
1054	affil
1055	str "Howard Hughes Medical Institute, University of Iowa College
1056	of Medicine, Iowa City 52242." } ,
1057	from
1058	journal {
1059	title {
1060	iso-jta "Nature" ,
1061	ml-jta "Nature" ,
1062	issn "0028-0836" ,
1063	name "Nature" } ,
1064	imp {
1065	date
1066	std {
1067	year 1992 ,
1068	month 9 ,
1069	day 24 } ,
1070	volume "359" ,
1071	issue "6393" ,
1072	pages "320-322" ,
1073	language "eng" ,
1074	pubstatus ppublish ,
1075	history {
1076	{
1077	pubstatus pubmed ,
1078	date
1079	std {
1080	year 1992 ,
1081	month 9 ,
1082	day 24 } } ,
1083	{
1084	pubstatus medline ,
1085	date
1086	std {
1087	year 1992 ,
1088	month 9 ,
1089	day 24 ,
1090	hour 0 ,
1091	minute 1 } } } } } ,
1092	ids {
1093	pubmed 1406935 ,
1094	doi "10.1038/359320a0" } } } } ,
1095	update-date
1096	std {
1097	year 2008 ,
1098	month 2 ,
1099	day 11 } } ,
1100	seq-set {
1101	seq {
1102	id {
1103	other {
1104	accession "NM_004393" ,
1105	version 2 } ,
1106	gi 148539834 } ,
1107	descr {
1108	molinfo {
1109	biomol mRNA ,
1110	completeness has-right } ,
1111	title "Homo sapiens dystroglycan 1 (dystrophin-associated glycoprotein
1112	1) (DAG1), mRNA" ,
1113	create-date
1114	std {
1115	year 1999 ,
1116	month 5 ,
1117	day 7 } } ,
1118	inst {
1119	repr raw ,
1120	mol rna ,
1121	length 5537 ,
1122	seq-data
1123	ncbi2na '2920969A6668494B69966689E967A3E9E411D9BB4A6BE729D696665595F
1124	99D265774595AC6E76660A79A6699D9977CA7E9AE9A69A49F6658355AA269AE9A6D7AA528A2604
1125	5E59AD7565A67A9DEEE75A8E892BB922AE20549DEA142D1F9F5F1F2421CD87E2407E85EA38A3B7
1126	BA977679E79577AA8A17F75D79DDEEBCE9D2D51E952E05748A7B4A87A80149F8A4D4E474B9DD21
1127	7518A7BD512EBE93D78E91A7B6DA99D3F62E14F5048FE3E5D4BA2334D0ACD2692A0A29FE537E9E
1128	47A8744894457A2A5D55F8478C2AEE4F13F4B899C469EAA506A251355485D4BBBDD4D8ADC57821
1129	44B89E4B6B8A125D54857AE2BACD3797B9E68E05EE1EFF86B8FFA396174508E15409028F85D791
1130	28E689F7482C89F441380F2E5AEB8304873F84EDA5F4E9E95A80E4002BAE883AA57DDD7A09EA79
1131	D5E05204BB9784F4EBB2295794A8A990EDE749FA715EEBABE913650C20955DF54066D68A48D4E7
1132	115117B4794FA955051A735289553528DB941551375253E75D412214E9D752D2A35EF5EA0151AD
1133	14D68762994F3D015415CA553525C76AED209E9144BD7A523D95063853D7A73BA25C792F9C55D5
1134	105145082518B351140149065F41E1D4514518764A50508051A115694B956AD14502FD4D148FA0
1135	1E5D165C76CF6451452E8B956E9A205414995227420533E12AC8E5EAFA45C7F8AE08D5B4847F73
1136	8538A11451E109E09E15E01E6A24927AEA620B5EAC4BD04904949D3B3A5F56124946EA40462CFD
1137	393944842AA97B69EE8E5F62351B51299550AA32A75E42BD0A50BFBAB85691EBBE0E13510823E5
1138	FAC0807A5F65FE885807B2453457920CD15AA7536EBA0E8504111E57E895E550A248D9EA78965A
1139	3678A38E801769797DD4195C89787F0A5109347B86A77A4BEDA45C4BF357BAC515288B95D22996
1140	54482E5E12A15E20892E28E3B7179112D3D696EBAD92535E74F9E934F94E379C59082682A427C5
1141	7E2852945F4D082AAE5CD37F92181E861D42554575D4939474F7928A20A755C5575E2C550522EE
1142	5621475DE0528453A88B119579A8E28D50E65D5C52554595F449153A2A42A756D50813855316B4
1143	5D7573B545F0564265EAE8A4AB2A4AA5E88613AEFB7BA216BA5E4853E545A89611785C9111E112
1144	A97A109595DDEB5D501540927A221FEA87FFCFFCFFF97049FFAFEF4C883DF67D3FF8E9E9DE0245
1145	3BA2E8AE8A898A0538381D9292E5A9A557A7779BFE5FC11C1EC7BFFDCF46EEDC9E4A3B04E8012C
1146	1C08F03D0287F482F0AF0BFF1BF0DE7BF1701FB3B30FFEAEACEA83E7F9C00C2754ABBF407C8821
1147	42A12CFFF340A0C73FFD11C6D07EBE778C55225E3EAA5D5A57A74650B57AE7ABF9DD59EF94AA7A
1148	09E8AADDFA94E84D547D4953B11CBA546142AB7D3F53800A87508A4BAE9EE95507FAE752AEA527
1149	9FBAA917A8AD02B75144D05CFFBFC57FF7B93EFFFFFD75C0283346BFFE011D2EAA13FEB82390CF
1150	FCED3B8E77F5D1F85FA59FED704B512D795615154D5FF77A4752D5297EA5E071E802B7A69EA8A2
1151	E52432F4C30037BC9DD0270FFF1C0BFF3125D03EFF3C00023F00EB8E7C492FEC6277C2EF8F53A0
1152	7869FE7EFF8F7FD55C7FD70EBF03DE83C47AAF7FE5FFF248135B5B5379377B54E1D2A9951DE7D8
1153	F75D7BA08053FE24E1FF7E3B7826F3FEAC7FF2A28397F6430ECD4F578F8ABABABA1529D5FE4448
1154	9271F7094CD87BFE48A3FBBB9E5D28AA2A7ACA2AAA22B77B5C79DD48A93F55F997DD512A549577
1155	55E552D54AAB1DE8B892E55EEAA25EC0E6A74BA147AE1EA74E5D42D22FD5EB954884A2442EA378
1156	5EB88F3F78E174D000C043D50EF52B8A9FE0297D4049D6D957241D453EA4794E4886E9E9520E97
1157	BE53241E8A63AA4B8120C104904397F92925E755E267A9EB8EB6FA1DEE23A2250DD13D0BBD1414
1158	78EEFFCFD7DCCE3FC23BBFDE4F7B020133407030092EDFCF10000000000'H ,
1159	hist {
1160	assembly {
1161	{
1162	type partial ,
1163	dim 2 ,
1164	segs
1165	denseg {
1166	dim 2 ,
1167	numseg 1 ,
1168	ids {
1169	gi 148539834 ,
1170	gi 81455866 } ,
1171	starts {
1172	0 ,
1173	0 } ,
1174	lens {
1175	65 } ,
1176	strands {
1177	plus ,
1178	plus } } } ,
1179	{
1180	type partial ,
1181	dim 2 ,
1182	segs
1183	denseg {
1184	dim 2 ,
1185	numseg 1 ,
1186	ids {
1187	gi 148539834 ,
1188	gi 33877876 } ,
1189	starts {
1190	65 ,
1191	0 } ,
1192	lens {
1193	2608 } ,
1194	strands {
1195	plus ,
1196	plus } } } ,
1197	{
1198	type partial ,
1199	dim 2 ,
1200	segs
1201	denseg {
1202	dim 2 ,
1203	numseg 1 ,
1204	ids {
1205	gi 148539834 ,
1206	gi 398025 } ,
1207	starts {
1208	2673 ,
1209	2649 } ,
1210	lens {
1211	1 } ,
1212	strands {
1213	plus ,
1214	plus } } } ,
1215	{
1216	type partial ,
1217	dim 2 ,
1218	segs
1219	denseg {
1220	dim 2 ,
1221	numseg 1 ,
1222	ids {
1223	gi 148539834 ,
1224	gi 33877876 } ,
1225	starts {
1226	2674 ,
1227	2609 } ,
1228	lens {
1229	1708 } ,
1230	strands {
1231	plus ,
1232	plus } } } ,
1233	{
1234	type partial ,
1235	dim 2 ,
1236	segs
1237	denseg {
1238	dim 2 ,
1239	numseg 1 ,
1240	ids {
1241	gi 148539834 ,
1242	gi 58554642 } ,
1243	starts {
1244	4382 ,
1245	97 } ,
1246	lens {
1247	491 } ,
1248	strands {
1249	plus ,
1250	plus } } } ,
1251	{
1252	type partial ,
1253	dim 2 ,
1254	segs
1255	denseg {
1256	dim 2 ,
1257	numseg 1 ,
1258	ids {
1259	gi 148539834 ,
1260	gi 46844012 } ,
1261	starts {
1262	4873 ,
1263	199 } ,
1264	lens {
1265	494 } ,
1266	strands {
1267	plus ,
1268	plus } } } ,
1269	{
1270	type partial ,
1271	dim 2 ,
1272	segs
1273	denseg {
1274	dim 2 ,
1275	numseg 1 ,
1276	ids {
1277	gi 148539834 ,
1278	gi 11547519 } ,
1279	starts {
1280	5367 ,
1281	0 } ,
1282	lens {
1283	152 } ,
1284	strands {
1285	plus ,
1286	minus } } } ,
1287	{
1288	type partial ,
1289	dim 2 ,
1290	segs
1291	denseg {
1292	dim 2 ,
1293	numseg 1 ,
1294	ids {
1295	gi 148539834 ,
1296	gi 6503484 } ,
1297	starts {
1298	5519 ,
1299	0 } ,
1300	lens {
1301	18 } ,
1302	strands {
1303	plus ,
1304	minus } } } } ,
1305	replaces {
1306	date
1307	std {
1308	year 2007 ,
1309	month 6 ,
1310	day 2 } ,
1311	ids {
1312	gi 4758115 } } } } ,
1313	annot {
1314	{
1315	data
1316	ftable {
1317	{
1318	data
1319	imp {
1320	key "polyA_signal" } ,
1321	location
1322	int {
1323	from 4347 ,
1324	to 4352 ,
1325	strand plus ,
1326	id
1327	gi 148539834 } } ,
1328	{
1329	data
1330	imp {
1331	key "polyA_site" } ,
1332	location
1333	pnt {
1334	point 4387 ,
1335	strand plus ,
1336	id
1337	gi 148539834 } } ,
1338	{
1339	data
1340	imp {
1341	key "polyA_signal" } ,
1342	location
1343	int {
1344	from 5497 ,
1345	to 5502 ,
1346	strand plus ,
1347	id
1348	gi 148539834 } } ,
1349	{
1350	data
1351	imp {
1352	key "polyA_site" } ,
1353	location
1354	pnt {
1355	point 5521 ,
1356	strand plus ,
1357	id
1358	gi 148539834 } } ,
1359	{
1360	data
1361	gene {
1362	locus "DAG1" ,
1363	desc "dystroglycan 1 (dystrophin-associated glycoprotein
1364	1)" ,
1365	syn {
1366	"A3a" ,
1367	"DAG" ,
1368	"AGRNR" ,
1369	"156DAG" } } ,
1370	location
1371	int {
1372	from 0 ,
1373	to 5536 ,
1374	strand plus ,
1375	id
1376	gi 148539834 } ,
1377	dbxref {
1378	{
1379	db "GeneID" ,
1380	tag
1381	id 1605 } ,
1382	{
1383	db "HGNC" ,
1384	tag
1385	id 2666 } ,
1386	{
1387	db "HPRD" ,
1388	tag
1389	str "HPRD_00546" } ,
1390	{
1391	db "MIM" ,
1392	tag
1393	id 128239 } } } } } ,
1394	{
1395	db other ,
1396	name "Annot:STS" ,
1397	data
1398	ftable {
1399	{
1400	data
1401	imp {
1402	key "STS" } ,
1403	location
1404	int {
1405	from 1789 ,
1406	to 2667 ,
1407	strand plus ,
1408	id
1409	gi 148539834 } ,
1410	qual {
1411	{
1412	qual "standard_name" ,
1413	val "PMC28400P1" } } ,
1414	dbxref {
1415	{
1416	db "UniSTS" ,
1417	tag
1418	id 272410 } } } ,
1419	{
1420	data
1421	imp {
1422	key "STS" } ,
1423	location
1424	int {
1425	from 3429 ,
1426	to 3771 ,
1427	strand plus ,
1428	id
1429	gi 148539834 } ,
1430	qual {
1431	{
1432	qual "standard_name" ,
1433	val "D3S3337" } } ,
1434	dbxref {
1435	{
1436	db "UniSTS" ,
1437	tag
1438	id 5975 } } } ,
1439	{
1440	data
1441	imp {
1442	key "STS" } ,
1443	location
1444	int {
1445	from 2630 ,
1446	to 2791 ,
1447	strand plus ,
1448	id
1449	gi 148539834 } ,
1450	qual {
1451	{
1452	qual "standard_name" ,
1453	val "GDB:215839" } } ,
1454	dbxref {
1455	{
1456	db "UniSTS" ,
1457	tag
1458	id 156205 } } } ,
1459	{
1460	data
1461	imp {
1462	key "STS" } ,
1463	location
1464	int {
1465	from 4139 ,
1466	to 4265 ,
1467	strand plus ,
1468	id
1469	gi 148539834 } ,
1470	qual {
1471	{
1472	qual "standard_name" ,
1473	val "Bdy62f05" } } ,
1474	dbxref {
1475	{
1476	db "UniSTS" ,
1477	tag
1478	id 36695 } } } ,
1479	{
1480	data
1481	imp {
1482	key "STS" } ,
1483	location
1484	int {
1485	from 4553 ,
1486	to 4707 ,
1487	strand plus ,
1488	id
1489	gi 148539834 } ,
1490	qual {
1491	{
1492	qual "standard_name" ,
1493	val "G54125" } } ,
1494	dbxref {
1495	{
1496	db "UniSTS" ,
1497	tag
1498	id 109362 } } } } } ,
1499	{
1500	db other ,
1501	name "Annot:Exon" ,
1502	desc {
1503	title "NM exons based on Splign alignments" } ,
1504	data
1505	ftable {
1506	{
1507	data
1508	imp {
1509	key "exon" } ,
1510	location
1511	int {
1512	from 0 ,
1513	to 301 ,
1514	strand plus ,
1515	id
1516	gi 148539834 } ,
1517	qual {
1518	{
1519	qual "number" ,
1520	val "1" } ,
1521	{
1522	qual "inference" ,
1523	val "alignment:Splign" } } } ,
1524	{
1525	data
1526	imp {
1527	key "exon" } ,
1528	location
1529	int {
1530	from 302 ,
1531	to 702 ,
1532	strand plus ,
1533	id
1534	gi 148539834 } ,
1535	qual {
1536	{
1537	qual "number" ,
1538	val "2" } ,
1539	{
1540	qual "inference" ,
1541	val "alignment:Splign" } } } ,
1542	{
1543	data
1544	imp {
1545	key "exon" } ,
1546	location
1547	int {
1548	from 703 ,
1549	to 5521 ,
1550	strand plus ,
1551	id
1552	gi 148539834 } ,
1553	qual {
1554	{
1555	qual "number" ,
1556	val "3" } ,
1557	{
1558	qual "inference" ,
1559	val "alignment:Splign" } } } } } } } ,
1560	seq {
1561	id {
1562	other {
1563	accession "NP_004384" ,
1564	version 2 } ,
1565	gi 148539835 } ,
1566	descr {
1567	molinfo {
1568	biomol peptide } ,
1569	title "dystroglycan 1 preproprotein [Homo sapiens]" ,
1570	create-date
1571	std {
1572	year 1999 ,
1573	month 5 ,
1574	day 7 } } ,
1575	inst {
1576	repr raw ,
1577	mol aa ,
1578	length 895 ,
1579	seq-data
1580	ncbieaa "MRMSVGLSLLLPLWGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHE
1581	AVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATR
1582	LGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMR
1583	SFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYP
1584	VVGWHIANKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIR
1585	TRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTTTKKPRVSTPKPATPSTDSTTTTTRRP
1586	TKKPRTPRPVPRVTTKVSITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHE
1587	DTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAP
1588	ARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNTLPLEPCPKEQIAGLSRRIAE
1589	DDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVA
1590	AILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPET
1591	TPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP" ,
1592	hist {
1593	replaces {
1594	date
1595	std {
1596	year 2007 ,
1597	month 6 ,
1598	day 2 } ,
1599	ids {
1600	gi 4758116 } } } } ,
1601	annot {
1602	{
1603	data
1604	ftable {
1605	{
1606	data
1607	prot {
1608	processed signal-peptide } ,
1609	location
1610	int {
1611	from 0 ,
1612	to 28 ,
1613	id
1614	gi 148539835 } } ,
1615	{
1616	data
1617	prot {
1618	name {
1619	"dystroglycan 1 proprotein" } ,
1620	processed preprotein } ,
1621	location
1622	int {
1623	from 29 ,
1624	to 894 ,
1625	id
1626	gi 148539835 } } ,
1627	{
1628	data
1629	prot {
1630	name {
1631	"alpha-dystroglycan" } ,
1632	processed mature } ,
1633	location
1634	int {
1635	from 29 ,
1636	to 652 ,
1637	id
1638	gi 148539835 } } ,
1639	{
1640	data
1641	prot {
1642	name {
1643	"beta-dystroglycan" } ,
1644	processed mature } ,
1645	location
1646	int {
1647	from 653 ,
1648	to 894 ,
1649	id
1650	gi 148539835 } } ,
1651	{
1652	data
1653	prot {
1654	name {
1655	"dystroglycan 1 preproprotein" ,
1656	"alpha-dystroglycan" ,
1657	"dystrophin-associated glycoprotein-1" ,
1658	"beta-dystroglycan" } } ,
1659	location
1660	int {
1661	from 0 ,
1662	to 894 ,
1663	id
1664	gi 148539835 } } } } ,
1665	{
1666	db other ,
1667	name "Annot:CDD" ,
1668	desc {
1669	name "CDDSearch" ,
1670	create-date
1671	std {
1672	year 2007 ,
1673	month 6 ,
1674	day 5 ,
1675	hour 13 ,
1676	minute 47 ,
1677	second 25 } } ,
1678	data
1679	ftable {
1680	{
1681	data
1682	region "CADG" ,
1683	comment "Dystroglycan-type cadherin-like domains.
1684	Cadherin-homologous domains present in metazoan dystroglycans and
1685	alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from
1686	magnetotactic bacteria. Likely to bind calcium ions." ,
1687	location
1688	int {
1689	from 498 ,
1690	to 598 ,
1691	id
1692	gi 148539835 } ,
1693	ext {
1694	type
1695	str "cddScoreData" ,
1696	data {
1697	{
1698	label
1699	str "definition" ,
1700	data
1701	str "smart00736" } ,
1702	{
1703	label
1704	str "short_name" ,
1705	data
1706	str "CADG" } ,
1707	{
1708	label
1709	str "score" ,
1710	data
1711	int 188 } ,
1712	{
1713	label
1714	str "evalue" ,
1715	data
1716	real { 164132, 10, -19 } } ,
1717	{
1718	label
1719	str "bit_score" ,
1720	data
1721	real { 765172, 10, -4 } } } } ,
1722	dbxref {
1723	{
1724	db "CDD" ,
1725	tag
1726	id 48003 } } } ,
1727	{
1728	data
1729	region "CADG" ,
1730	comment "Dystroglycan-type cadherin-like domains.
1731	Cadherin-homologous domains present in metazoan dystroglycans and
1732	alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from
1733	magnetotactic bacteria. Likely to bind calcium ions." ,
1734	location
1735	int {
1736	from 63 ,
1737	to 161 ,
1738	id
1739	gi 148539835 } ,
1740	ext {
1741	type
1742	str "cddScoreData" ,
1743	data {
1744	{
1745	label
1746	str "definition" ,
1747	data
1748	str "smart00736" } ,
1749	{
1750	label
1751	str "short_name" ,
1752	data
1753	str "CADG" } ,
1754	{
1755	label
1756	str "score" ,
1757	data
1758	int 177 } ,
1759	{
1760	label
1761	str "evalue" ,
1762	data
1763	real { 285713, 10, -18 } } ,
1764	{
1765	label
1766	str "bit_score" ,
1767	data
1768	real { 7228, 10, -2 } } } } ,
1769	dbxref {
1770	{
1771	db "CDD" ,
1772	tag
1773	id 48003 } } } ,
1774	{
1775	data
1776	region "DAG1" ,
1777	partial TRUE ,
1778	comment "Dystroglycan (Dystrophin-associated glycoprotein 1).
1779	Dystroglycan is one of the dystrophin-associated glycoproteins, which is
1780	encoded by a 5.5 kb transcript in human." ,
1781	location
1782	int {
1783	from 467 ,
1784	to 883 ,
1785	id
1786	gi 148539835 ,
1787	fuzz-from
1788	lim lt } ,
1789	ext {
1790	type
1791	str "cddScoreData" ,
1792	data {
1793	{
1794	label
1795	str "definition" ,
1796	data
1797	str "pfam05454" } ,
1798	{
1799	label
1800	str "short_name" ,
1801	data
1802	str "DAG1" } ,
1803	{
1804	label
1805	str "score" ,
1806	data
1807	int 1364 } ,
1808	{
1809	label
1810	str "evalue" ,
1811	data
1812	real { 643304, 10, -156 } } ,
1813	{
1814	label
1815	str "bit_score" ,
1816	data
1817	real { 52977, 10, -2 } } } } ,
1818	dbxref {
1819	{
1820	db "CDD" ,
1821	tag
1822	id 69003 } } } ,
1823	{
1824	data
1825	region "DAG1" ,
1826	partial TRUE ,
1827	comment "Dystroglycan (Dystrophin-associated glycoprotein 1).
1828	Dystroglycan is one of the dystrophin-associated glycoproteins, which is
1829	encoded by a 5.5 kb transcript in human." ,
1830	location
1831	int {
1832	from 41 ,
1833	to 411 ,
1834	id
1835	gi 148539835 ,
1836	fuzz-to
1837	lim gt } ,
1838	ext {
1839	type
1840	str "cddScoreData" ,
1841	data {
1842	{
1843	label
1844	str "definition" ,
1845	data
1846	str "pfam05454" } ,
1847	{
1848	label
1849	str "short_name" ,
1850	data
1851	str "DAG1" } ,
1852	{
1853	label
1854	str "score" ,
1855	data
1856	int 1303 } ,
1857	{
1858	label
1859	str "evalue" ,
1860	data
1861	real { 62179, 10, -148 } } ,
1862	{
1863	label
1864	str "bit_score" ,
1865	data
1866	real { 506273, 10, -3 } } } } ,
1867	dbxref {
1868	{
1869	db "CDD" ,
1870	tag
1871	id 69003 } } } } } } } } ,
1872	annot {
1873	{
1874	data
1875	ftable {
1876	{
1877	data
1878	cdregion {
1879	code {
1880	id 1 } } ,
1881	product
1882	whole
1883	gi 148539835 ,
1884	location
1885	int {
1886	from 418 ,
1887	to 3105 ,
1888	strand plus ,
1889	id
1890	gi 148539834 } ,
1891	dbxref {
1892	{
1893	db "CCDS" ,
1894	tag
1895	str "CCDS2799.1" } } } } } } }
1896

Download in other formats:

Original Format